BLASTX nr result
ID: Magnolia22_contig00035311
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035311 (409 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EME46656.1 hypothetical protein DOTSEDRAFT_149048 [Dothistroma s... 57 1e-07 >EME46656.1 hypothetical protein DOTSEDRAFT_149048 [Dothistroma septosporum NZE10] Length = 146 Score = 57.0 bits (136), Expect = 1e-07 Identities = 27/46 (58%), Positives = 32/46 (69%) Frame = +3 Query: 3 EDKAAIDAEVRGGDNDIRSNIRQGGETVRPAGSLSNNAADGTGKST 140 EDKA I A+ GGD+ +R NIRQGGET+RP G SN + GTG T Sbjct: 100 EDKARIYADQNGGDDAVRGNIRQGGETIRPGGGDSNESQGGTGGRT 145