BLASTX nr result
ID: Magnolia22_contig00035039
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00035039 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013258618.1 hypothetical protein A1O9_07609 [Exophiala aquama... 55 2e-06 KIW67755.1 hypothetical protein PV04_06986 [Capronia semi-immersa] 53 8e-06 >XP_013258618.1 hypothetical protein A1O9_07609 [Exophiala aquamarina CBS 119918] KEF56028.1 hypothetical protein A1O9_07609 [Exophiala aquamarina CBS 119918] Length = 226 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +2 Query: 281 LEMALHQNLYKVIEFDQIQTLNEAESRSGAKVVQKEW 391 LE AL NLYK IEF+ I TLNEAESRSGA +VQK W Sbjct: 32 LEPALQSNLYKQIEFEGIVTLNEAESRSGAAIVQKTW 68 >KIW67755.1 hypothetical protein PV04_06986 [Capronia semi-immersa] Length = 223 Score = 53.1 bits (126), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = +2 Query: 281 LEMALHQNLYKVIEFDQIQTLNEAESRSGAKVVQKEW 391 LE AL NLYK I+F+ I TLNEAE+RSGA +VQK W Sbjct: 29 LEPALQSNLYKQIDFEGINTLNEAENRSGAAIVQKTW 65