BLASTX nr result
ID: Magnolia22_contig00034949
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00034949 (603 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010106215.1 hypothetical protein L484_003279 [Morus notabilis... 57 2e-07 CBI14999.3 unnamed protein product, partial [Vitis vinifera] 57 6e-06 CAN66422.1 hypothetical protein VITISV_007982 [Vitis vinifera] 57 6e-06 XP_002278672.1 PREDICTED: LRR receptor-like serine/threonine-pro... 57 6e-06 >XP_010106215.1 hypothetical protein L484_003279 [Morus notabilis] EXC08900.1 hypothetical protein L484_003279 [Morus notabilis] Length = 76 Score = 56.6 bits (135), Expect = 2e-07 Identities = 26/58 (44%), Positives = 34/58 (58%) Frame = +2 Query: 428 MGGIHKYCXXXXXXXXXXXXTATFGDSSTDSYWLLRIKSVLKDSEGVLASWSLQSDMC 601 M GI +C G++STDSYWLLRIKS L D +GV+ SWSL +++C Sbjct: 1 MAGIQLFCFMLLYAVLGAVLVDAHGENSTDSYWLLRIKSELDDPKGVMESWSLDANVC 58 >CBI14999.3 unnamed protein product, partial [Vitis vinifera] Length = 903 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 494 TFGDSSTDSYWLLRIKSVLKDSEGVLASWSLQSDMC 601 TFGD+STDSYWLLRIKS L D GVLA+WS ++++C Sbjct: 14 TFGDNSTDSYWLLRIKSELVDPVGVLANWSSRTNIC 49 >CAN66422.1 hypothetical protein VITISV_007982 [Vitis vinifera] Length = 913 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 494 TFGDSSTDSYWLLRIKSVLKDSEGVLASWSLQSDMC 601 TFGD+STDSYWLLRIKS L D GVLA+WS ++++C Sbjct: 23 TFGDNSTDSYWLLRIKSELVDPVGVLANWSSRTNIC 58 >XP_002278672.1 PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO1 [Vitis vinifera] Length = 974 Score = 56.6 bits (135), Expect = 6e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = +2 Query: 494 TFGDSSTDSYWLLRIKSVLKDSEGVLASWSLQSDMC 601 TFGD+STDSYWLLRIKS L D GVLA+WS ++++C Sbjct: 23 TFGDNSTDSYWLLRIKSELVDPVGVLANWSSRTNIC 58