BLASTX nr result
ID: Magnolia22_contig00034934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00034934 (422 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007204440.1 hypothetical protein PRUPE_ppa027027mg, partial [... 53 5e-06 >XP_007204440.1 hypothetical protein PRUPE_ppa027027mg, partial [Prunus persica] Length = 140 Score = 52.8 bits (125), Expect = 5e-06 Identities = 30/82 (36%), Positives = 42/82 (51%) Frame = -2 Query: 418 PNICLLCGRNSETVNHLFTHYPLSSKVWYAVLVQFQLLLGYNKICN*VVYGMARGYSEKR 239 PN C+LC ++SETV+HLF P++S +W + L G C+ V+ + KR Sbjct: 25 PNWCVLCKKDSETVDHLFLLCPIASSLWAKLFQVAGLTWGSLATCSAVLEARLNFFGGKR 84 Query: 238 QGIVATLCVIWEERNRRFFHDV 173 +G ERNRR F DV Sbjct: 85 KG---------SERNRRIFEDV 97