BLASTX nr result
ID: Magnolia22_contig00034779
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00034779 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value JAV00750.1 Pentatricopeptide repeat-containing protein, mitochon... 150 1e-42 KYP77915.1 hypothetical protein KK1_049822, partial [Cajanus cajan] 146 1e-42 KNA09713.1 hypothetical protein SOVF_151120 [Spinacia oleracea] 155 6e-42 JAU55176.1 Pentatricopeptide repeat-containing protein, mitochon... 148 5e-41 XP_010044695.1 PREDICTED: pentatricopeptide repeat-containing pr... 152 1e-40 XP_010548335.1 PREDICTED: pentatricopeptide repeat-containing pr... 152 1e-40 XP_010923304.1 PREDICTED: pentatricopeptide repeat-containing pr... 151 2e-40 OMO51651.1 hypothetical protein CCACVL1_29667 [Corchorus capsula... 150 4e-40 ONK64832.1 uncharacterized protein A4U43_C07F30430 [Asparagus of... 147 5e-40 XP_006438554.1 hypothetical protein CICLE_v10033899mg [Citrus cl... 150 5e-40 OEL24439.1 Pentatricopeptide repeat-containing protein [Dichanth... 147 5e-40 KDO82711.1 hypothetical protein CISIN_1g038206mg [Citrus sinensis] 150 6e-40 XP_006483265.1 PREDICTED: pentatricopeptide repeat-containing pr... 150 6e-40 XP_004955722.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 1e-39 XP_016548360.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 1e-39 XP_010256087.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 1e-39 XP_010256079.1 PREDICTED: pentatricopeptide repeat-containing pr... 149 2e-39 CDP00269.1 unnamed protein product [Coffea canephora] 149 2e-39 XP_002459490.1 hypothetical protein SORBIDRAFT_02g005450 [Sorghu... 145 2e-39 OMO55094.1 hypothetical protein COLO4_36206 [Corchorus olitorius] 149 2e-39 >JAV00750.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Noccaea caerulescens] Length = 252 Score = 150 bits (378), Expect = 1e-42 Identities = 71/99 (71%), Positives = 79/99 (79%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVCS 180 EKL S+GY+PD SQA + D +K +SLRLHSERLAIAFGLLN P TPIRI KNLRVCS Sbjct: 154 EKLSSIGYSPDRSQAPLVDATKDKEYSLRLHSERLAIAFGLLNLPPQTPIRIFKNLRVCS 213 Query: 181 DCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCH +TKLIS +F+ EIIVRDR RFH FK G CSC DYW Sbjct: 214 DCHQVTKLISKIFNTEIIVRDRVRFHHFKDGSCSCSDYW 252 >KYP77915.1 hypothetical protein KK1_049822, partial [Cajanus cajan] Length = 147 Score = 146 bits (369), Expect = 1e-42 Identities = 67/99 (67%), Positives = 83/99 (83%), Gaps = 1/99 (1%) Frame = +1 Query: 4 KLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVCS 180 K+ S+GY PD S A + D +D K+++LRLHSERLAIAFG+LN++PGTPIR+ KNLRVC+ Sbjct: 49 KMESIGYLPDYSGAPMVDEVNDGKQNALRLHSERLAIAFGILNSRPGTPIRVFKNLRVCN 108 Query: 181 DCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCH +TKLIS +++VEIIVRDR RFH FK G CSCMDYW Sbjct: 109 DCHRVTKLISRIYNVEIIVRDRARFHHFKDGACSCMDYW 147 >KNA09713.1 hypothetical protein SOVF_151120 [Spinacia oleracea] Length = 613 Score = 155 bits (393), Expect = 6e-42 Identities = 73/101 (72%), Positives = 84/101 (83%), Gaps = 2/101 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADHDDE--KRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRV 174 E+L SVGY PD+SQA + D +DE K+H+L+LHSERLAIAFGLLN KPG PIRI KNLRV Sbjct: 513 ERLHSVGYKPDISQAPLVDDEDEDQKQHALKLHSERLAIAFGLLNQKPGVPIRIFKNLRV 572 Query: 175 CSDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 C+DCH +TKLIS +FDVEI+VRDR RFH FK G CSC DYW Sbjct: 573 CNDCHEVTKLISDIFDVEIVVRDRARFHHFKDGSCSCADYW 613 >JAU55176.1 Pentatricopeptide repeat-containing protein, mitochondrial, partial [Noccaea caerulescens] Length = 328 Score = 148 bits (373), Expect = 5e-41 Identities = 70/99 (70%), Positives = 78/99 (78%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVCS 180 EKL S+GY+PD SQA + D +K +SLRLHSERLAIAFGLLN P TPIRI KNLRVC Sbjct: 230 EKLSSIGYSPDRSQAPLVDATKDKEYSLRLHSERLAIAFGLLNLPPQTPIRIFKNLRVCR 289 Query: 181 DCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCH +TKLIS +F+ EIIVRDR RFH FK G CSC DYW Sbjct: 290 DCHQVTKLISKIFNTEIIVRDRVRFHHFKDGSCSCSDYW 328 >XP_010044695.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Eucalyptus grandis] KCW86794.1 hypothetical protein EUGRSUZ_B03402 [Eucalyptus grandis] Length = 614 Score = 152 bits (384), Expect = 1e-40 Identities = 72/101 (71%), Positives = 82/101 (81%), Gaps = 2/101 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIA--DHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRV 174 EKL S GY PD+SQA + +H +EK SLRLHSERLAIAFGLLN K GTPIR+ KNLRV Sbjct: 514 EKLESAGYVPDVSQASMINDEHSEEKEQSLRLHSERLAIAFGLLNRKQGTPIRVFKNLRV 573 Query: 175 CSDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 C+DCH +TKLIS +++VEI VRDRTRFH FK G CSCMDYW Sbjct: 574 CNDCHKVTKLISKIYNVEITVRDRTRFHHFKHGCCSCMDYW 614 >XP_010548335.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Tarenaya hassleriana] XP_010548342.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Tarenaya hassleriana] XP_010548350.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Tarenaya hassleriana] XP_010548358.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Tarenaya hassleriana] XP_010548366.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Tarenaya hassleriana] XP_010548374.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Tarenaya hassleriana] Length = 619 Score = 152 bits (384), Expect = 1e-40 Identities = 74/104 (71%), Positives = 82/104 (78%), Gaps = 5/104 (4%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIAD-----HDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKN 165 EKL SVGY+PD SQA + D DD K +SLRLHSERLAIAFGL+N+KPG PIR+ KN Sbjct: 516 EKLKSVGYSPDQSQAPLVDVCNDDDDDSKENSLRLHSERLAIAFGLINSKPGAPIRVFKN 575 Query: 166 LRVCSDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 LRVCSDCH +TKLIS VF+ EIIVRDR RFH FK G CSC DYW Sbjct: 576 LRVCSDCHEVTKLISGVFETEIIVRDRVRFHHFKDGSCSCSDYW 619 >XP_010923304.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Elaeis guineensis] Length = 573 Score = 151 bits (381), Expect = 2e-40 Identities = 74/99 (74%), Positives = 80/99 (80%), Gaps = 1/99 (1%) Frame = +1 Query: 4 KLVSVGYTPDLSQAH-IADHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVCS 180 KL VGY PD SQA +A+ DD K SLR HSERLAIAFGLLN PGTPIRILKNLRVC Sbjct: 475 KLALVGYKPDSSQAPMVAEFDDAKEDSLRFHSERLAIAFGLLNRAPGTPIRILKNLRVCR 534 Query: 181 DCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCH +TKLIS ++VEIIVRDRTRFH F+ GLCSCMDYW Sbjct: 535 DCHAITKLISQEYNVEIIVRDRTRFHHFRDGLCSCMDYW 573 >OMO51651.1 hypothetical protein CCACVL1_29667 [Corchorus capsularis] Length = 613 Score = 150 bits (380), Expect = 4e-40 Identities = 72/100 (72%), Positives = 81/100 (81%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 EKL SVGY PD SQA + D DD ++HSLRLHSERLAIA GLL KPG PIRI KNLRVC Sbjct: 514 EKLASVGYLPDHSQAVMVDELDDTRQHSLRLHSERLAIALGLLKLKPGMPIRIFKNLRVC 573 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 +DCH +TKLIS +F+VEI+VRDR RFH FK G CSC+DYW Sbjct: 574 NDCHEVTKLISRIFNVEIVVRDRARFHHFKDGSCSCLDYW 613 >ONK64832.1 uncharacterized protein A4U43_C07F30430 [Asparagus officinalis] Length = 385 Score = 147 bits (370), Expect = 5e-40 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAH-IADHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 +KL SVGY PD SQA +A + K SL+ HSER+AIAFGLLNAK G PIR+LKNLRVC Sbjct: 286 DKLASVGYRPDSSQAPMVAGVEGVKSGSLKFHSERIAIAFGLLNAKKGMPIRVLKNLRVC 345 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCHT+TKLIS +DVEI+VRDRTRFH FK G CSCMDYW Sbjct: 346 GDCHTMTKLISRAYDVEIVVRDRTRFHHFKDGSCSCMDYW 385 >XP_006438554.1 hypothetical protein CICLE_v10033899mg [Citrus clementina] ESR51794.1 hypothetical protein CICLE_v10033899mg [Citrus clementina] Length = 597 Score = 150 bits (379), Expect = 5e-40 Identities = 73/100 (73%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 EKL S GYTPD SQA + D DD K+ SLRLHSERLAIA G+LN KPG PIR+ KNLRVC Sbjct: 498 EKLKSRGYTPDYSQAAMVDELDDGKQSSLRLHSERLAIALGILNLKPGMPIRVFKNLRVC 557 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCH +TKLIS +F+VEIIVRDR RFH FK G CSCMDYW Sbjct: 558 KDCHEVTKLISRIFNVEIIVRDRARFHHFKDGSCSCMDYW 597 >OEL24439.1 Pentatricopeptide repeat-containing protein [Dichanthelium oligosanthes] Length = 392 Score = 147 bits (370), Expect = 5e-40 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAH-IADHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 ++L S GY PDLS+A +AD D K +LRLHSERLAI+FGLLNA PG PIRILKNLRVC Sbjct: 293 QRLASAGYKPDLSEAPMVADIDHTKGATLRLHSERLAISFGLLNATPGAPIRILKNLRVC 352 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCHT++KLIS ++DVEIIVRDR RFH FK G CSC DYW Sbjct: 353 KDCHTISKLISKLYDVEIIVRDRIRFHHFKDGSCSCKDYW 392 >KDO82711.1 hypothetical protein CISIN_1g038206mg [Citrus sinensis] Length = 614 Score = 150 bits (379), Expect = 6e-40 Identities = 73/100 (73%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 EKL S GYTPD SQA + D DD K+ SLRLHSERLAIA G+LN KPG PIR+ KNLRVC Sbjct: 515 EKLKSRGYTPDYSQAAMVDELDDGKQSSLRLHSERLAIALGILNLKPGMPIRVFKNLRVC 574 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCH +TKLIS +F+VEIIVRDR RFH FK G CSCMDYW Sbjct: 575 KDCHEVTKLISRIFNVEIIVRDRARFHHFKDGSCSCMDYW 614 >XP_006483265.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Citrus sinensis] Length = 614 Score = 150 bits (379), Expect = 6e-40 Identities = 73/100 (73%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 EKL S GYTPD SQA + D DD K+ SLRLHSERLAIA G+LN KPG PIR+ KNLRVC Sbjct: 515 EKLKSRGYTPDYSQAAMVDELDDGKQSSLRLHSERLAIALGILNLKPGMPIRVFKNLRVC 574 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCH +TKLIS +F+VEIIVRDR RFH FK G CSCMDYW Sbjct: 575 KDCHEVTKLISRIFNVEIIVRDRARFHHFKDGSCSCMDYW 614 >XP_004955722.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Setaria italica] Length = 562 Score = 149 bits (376), Expect = 1e-39 Identities = 72/100 (72%), Positives = 82/100 (82%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAH-IADHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 E+L S GY PDLS+A +AD D K +LRLHSERLAI+FGLLNA+PG PIRILKNLRVC Sbjct: 463 ERLTSAGYKPDLSEAPMVADADRTKGATLRLHSERLAISFGLLNARPGAPIRILKNLRVC 522 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCHT++KLIS ++DVEIIVRDR RFH FK G CSC DYW Sbjct: 523 KDCHTISKLISKLYDVEIIVRDRIRFHHFKDGSCSCKDYW 562 >XP_016548360.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial [Capsicum annuum] Length = 601 Score = 149 bits (377), Expect = 1e-39 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 E+L S GY PDLSQA D D+ KR SL+LHSERLAIA+GLL KPGTP+RI KNLR+C Sbjct: 502 ERLKSAGYVPDLSQASTVDELDNGKRQSLKLHSERLAIAYGLLKLKPGTPLRIFKNLRIC 561 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 SDCH +TKLIS VFDVEIIVRDR RFH F+ G C+C DYW Sbjct: 562 SDCHNVTKLISKVFDVEIIVRDRVRFHHFRNGSCTCKDYW 601 >XP_010256087.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial isoform X2 [Nelumbo nucifera] Length = 569 Score = 149 bits (376), Expect = 1e-39 Identities = 72/100 (72%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 E+L +GY PDLSQA + D D K HSLRLHSERLAIAFGLL ++PG PIRI KNLRVC Sbjct: 470 ERLELLGYVPDLSQAPMVDELQDGKEHSLRLHSERLAIAFGLLKSRPGVPIRIFKNLRVC 529 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 +DCH +TKLIS F+VEIIVRDR RFH FK GLCSC DYW Sbjct: 530 NDCHMVTKLISRAFNVEIIVRDRIRFHHFKDGLCSCKDYW 569 >XP_010256079.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial isoform X1 [Nelumbo nucifera] Length = 605 Score = 149 bits (376), Expect = 2e-39 Identities = 72/100 (72%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADH-DDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 E+L +GY PDLSQA + D D K HSLRLHSERLAIAFGLL ++PG PIRI KNLRVC Sbjct: 506 ERLELLGYVPDLSQAPMVDELQDGKEHSLRLHSERLAIAFGLLKSRPGVPIRIFKNLRVC 565 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 +DCH +TKLIS F+VEIIVRDR RFH FK GLCSC DYW Sbjct: 566 NDCHMVTKLISRAFNVEIIVRDRIRFHHFKDGLCSCKDYW 605 >CDP00269.1 unnamed protein product [Coffea canephora] Length = 609 Score = 149 bits (376), Expect = 2e-39 Identities = 71/100 (71%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADHD-DEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 EKL S+GY+PD+SQA + D D D K SLRLHSERLA+AFGLLN KPG PIRI KNLR C Sbjct: 510 EKLTSMGYSPDISQAAMVDEDGDGKGRSLRLHSERLAVAFGLLNQKPGVPIRIFKNLRFC 569 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 SDCH + KLIS +F+VE+IVRDR RFH F G CSCMDYW Sbjct: 570 SDCHNVIKLISKIFNVEVIVRDRLRFHHFLDGSCSCMDYW 609 >XP_002459490.1 hypothetical protein SORBIDRAFT_02g005450 [Sorghum bicolor] Length = 395 Score = 145 bits (367), Expect = 2e-39 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAH-IADHDDEKRHSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 ++L S GY PDLS+A +AD D K +LRLHSERLAI+FGLLN PG PIRILKNLRVC Sbjct: 296 QRLTSAGYKPDLSEAPMVADIDRTKGATLRLHSERLAISFGLLNVTPGAPIRILKNLRVC 355 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 DCHT++KLIS ++DVEIIVRDR RFH FK G CSC DYW Sbjct: 356 KDCHTISKLISKLYDVEIIVRDRIRFHHFKGGSCSCKDYW 395 >OMO55094.1 hypothetical protein COLO4_36206 [Corchorus olitorius] Length = 613 Score = 149 bits (376), Expect = 2e-39 Identities = 73/100 (73%), Positives = 81/100 (81%), Gaps = 1/100 (1%) Frame = +1 Query: 1 EKLVSVGYTPDLSQAHIADHDDEKR-HSLRLHSERLAIAFGLLNAKPGTPIRILKNLRVC 177 EKL SVGY PD SQA + D DE R HSL+LHSERLAIA GLL KPG PIRI KNLRVC Sbjct: 514 EKLASVGYLPDHSQAVMVDELDETRQHSLKLHSERLAIALGLLKLKPGMPIRIFKNLRVC 573 Query: 178 SDCHTLTKLISTVFDVEIIVRDRTRFHRFKAGLCSCMDYW 297 +DCH +TKLIS +F+VEIIVRDR+RFH FK G CSC+DYW Sbjct: 574 NDCHEVTKLISRIFNVEIIVRDRSRFHHFKDGSCSCLDYW 613