BLASTX nr result
ID: Magnolia22_contig00034770
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00034770 (382 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KQK85826.1 hypothetical protein SETIT_020742mg [Setaria italica] 72 2e-14 >KQK85826.1 hypothetical protein SETIT_020742mg [Setaria italica] Length = 74 Score = 72.4 bits (176), Expect = 2e-14 Identities = 34/36 (94%), Positives = 34/36 (94%) Frame = -3 Query: 377 RYSLGFWVIIRLCRRDGRVVQGVALELLCRLLFTEG 270 RYSL FW IIRLCRRDGRVVQGVALELLCRLLFTEG Sbjct: 17 RYSLSFWSIIRLCRRDGRVVQGVALELLCRLLFTEG 52