BLASTX nr result
ID: Magnolia22_contig00033850
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00033850 (421 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013268067.1 hypothetical protein Z518_09996 [Rhinocladiella m... 55 4e-06 >XP_013268067.1 hypothetical protein Z518_09996 [Rhinocladiella mackenziei CBS 650.93] KIX00931.1 hypothetical protein Z518_09996 [Rhinocladiella mackenziei CBS 650.93] Length = 294 Score = 54.7 bits (130), Expect = 4e-06 Identities = 26/49 (53%), Positives = 32/49 (65%) Frame = +3 Query: 15 YESPISDSQIQAMVFAQHMYNNNADAVAINPCLTMKQWPKQDDQLQRYF 161 +ESP+ DS + VFA M+ + AINPCLTMK W Q+D LQRYF Sbjct: 242 FESPMMDSSVDMNVFATSMFQDQIVPAAINPCLTMKDWAGQED-LQRYF 289