BLASTX nr result
ID: Magnolia22_contig00033534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00033534 (564 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAY47197.1 hypothetical protein MANES_06G060300 [Manihot esculenta] 55 9e-06 >OAY47197.1 hypothetical protein MANES_06G060300 [Manihot esculenta] Length = 475 Score = 55.5 bits (132), Expect = 9e-06 Identities = 30/54 (55%), Positives = 36/54 (66%) Frame = -2 Query: 563 LLLLYYFFMGLHASYDTAKASEERRAAGDPMPWKKLEEGSDTLPPSSMADSNTA 402 +LL+YYF GLHASYDTAK + ERR AGD WKKLEEG S + + + A Sbjct: 402 VLLVYYFLFGLHASYDTAKGAGERR-AGD--GWKKLEEGGAVSSQSGLGNESRA 452