BLASTX nr result
ID: Magnolia22_contig00033326
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00033326 (406 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW90864.1 hypothetical protein EUGRSUZ_A02911 [Eucalyptus grandis] 101 2e-22 XP_010062447.1 PREDICTED: hexose carrier protein HEX6 [Eucalyptu... 100 3e-22 XP_009362799.1 PREDICTED: hexose carrier protein HEX6-like [Pyru... 97 5e-22 XP_009362800.1 PREDICTED: hexose carrier protein HEX6-like [Pyru... 97 5e-22 XP_007038317.2 PREDICTED: hexose carrier protein HEX6 [Theobroma... 99 1e-21 EOY22818.1 Major facilitator superfamily protein, putative [Theo... 99 1e-21 XP_010275368.1 PREDICTED: hexose carrier protein HEX6 [Nelumbo n... 99 2e-21 XP_008775189.2 PREDICTED: hexose carrier protein HEX6-like [Phoe... 98 2e-21 XP_018859420.1 PREDICTED: hexose carrier protein HEX6-like [Jugl... 98 2e-21 XP_012858638.1 PREDICTED: hexose carrier protein HEX6-like [Eryt... 98 3e-21 XP_019191596.1 PREDICTED: hexose carrier protein HEX6 isoform X2... 97 4e-21 XP_019191595.1 PREDICTED: hexose carrier protein HEX6 isoform X1... 97 4e-21 XP_009362698.1 PREDICTED: hexose carrier protein HEX6-like [Pyru... 97 5e-21 XP_006385129.1 hypothetical protein POPTR_0004s24170g [Populus t... 97 5e-21 GAV75709.1 Sugar_tr domain-containing protein [Cephalotus follic... 92 6e-21 OMO98204.1 Sugar/inositol transporter [Corchorus olitorius] 97 8e-21 XP_008367298.1 PREDICTED: LOW QUALITY PROTEIN: hexose carrier pr... 97 8e-21 XP_009783890.1 PREDICTED: hexose carrier protein HEX6-like [Nico... 97 9e-21 XP_018721004.1 PREDICTED: hexose carrier protein HEX6 isoform X2... 96 1e-20 XP_008234428.1 PREDICTED: hexose carrier protein HEX6-like [Prun... 96 1e-20 >KCW90864.1 hypothetical protein EUGRSUZ_A02911 [Eucalyptus grandis] Length = 507 Score = 101 bits (251), Expect = 2e-22 Identities = 44/56 (78%), Positives = 48/56 (85%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNKLEGE 170 SGIFFFFGGWVAVMT F+YLLLPETKNIPIE+MD+VWREHWFWK IV N+ E Sbjct: 451 SGIFFFFGGWVAVMTAFVYLLLPETKNIPIEQMDRVWREHWFWKRIVDQENETTRE 506 >XP_010062447.1 PREDICTED: hexose carrier protein HEX6 [Eucalyptus grandis] Length = 514 Score = 100 bits (250), Expect = 3e-22 Identities = 43/52 (82%), Positives = 47/52 (90%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNK 158 SGIFFFFGGWVAVMT F+YLLLPETKNIPIE+MD+VWREHWFWK IV N+ Sbjct: 451 SGIFFFFGGWVAVMTAFVYLLLPETKNIPIEQMDRVWREHWFWKRIVDQENE 502 >XP_009362799.1 PREDICTED: hexose carrier protein HEX6-like [Pyrus x bretschneideri] Length = 272 Score = 97.4 bits (241), Expect = 5e-22 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNK 158 +GIFFFFGGWVAVMTVF+YL LPETKN+PIEKM+ VW+EHWFW+ IV D +K Sbjct: 214 AGIFFFFGGWVAVMTVFVYLFLPETKNVPIEKMEIVWQEHWFWRRIVGDSSK 265 >XP_009362800.1 PREDICTED: hexose carrier protein HEX6-like [Pyrus x bretschneideri] Length = 273 Score = 97.4 bits (241), Expect = 5e-22 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNK 158 +GIFFFFGGWVAVMTVF+YL LPETKN+PIEKM+ VW+EHWFW+ IV D +K Sbjct: 215 AGIFFFFGGWVAVMTVFVYLFLPETKNVPIEKMEIVWQEHWFWRRIVGDSSK 266 >XP_007038317.2 PREDICTED: hexose carrier protein HEX6 [Theobroma cacao] Length = 507 Score = 99.0 bits (245), Expect = 1e-21 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADR 152 SGIFFFFGGWVAVMT F+YLLLPETKN+PIEKM++VWREHW WK IV D+ Sbjct: 450 SGIFFFFGGWVAVMTTFVYLLLPETKNVPIEKMEKVWREHWLWKRIVGDQ 499 >EOY22818.1 Major facilitator superfamily protein, putative [Theobroma cacao] Length = 507 Score = 99.0 bits (245), Expect = 1e-21 Identities = 41/50 (82%), Positives = 46/50 (92%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADR 152 SGIFFFFGGWVAVMT F+YLLLPETKN+PIEKM++VWREHW WK IV D+ Sbjct: 450 SGIFFFFGGWVAVMTTFVYLLLPETKNVPIEKMEKVWREHWLWKRIVGDQ 499 >XP_010275368.1 PREDICTED: hexose carrier protein HEX6 [Nelumbo nucifera] XP_010275369.1 PREDICTED: hexose carrier protein HEX6 [Nelumbo nucifera] Length = 509 Score = 98.6 bits (244), Expect = 2e-21 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNK 158 SGIFFFFGGWVAVMT F+YLLLPETKN+PIE+MD+VWREHWFWK IV + + Sbjct: 451 SGIFFFFGGWVAVMTGFVYLLLPETKNVPIEQMDRVWREHWFWKRIVGEEKE 502 >XP_008775189.2 PREDICTED: hexose carrier protein HEX6-like [Phoenix dactylifera] Length = 410 Score = 97.8 bits (242), Expect = 2e-21 Identities = 39/57 (68%), Positives = 47/57 (82%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNKLEGED 173 SG+FFFFGGWV VMT+F+YLLLPETKN PIE+MD+VWREHWFWK ++ D + D Sbjct: 344 SGVFFFFGGWVLVMTIFVYLLLPETKNQPIEQMDRVWREHWFWKKVITDAEERRNMD 400 >XP_018859420.1 PREDICTED: hexose carrier protein HEX6-like [Juglans regia] Length = 462 Score = 98.2 bits (243), Expect = 2e-21 Identities = 41/52 (78%), Positives = 47/52 (90%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNK 158 SGIFFFFGGWV VM+VF+YLLLPETKN+PIE MD+VWREHWFWK IV + N+ Sbjct: 403 SGIFFFFGGWVVVMSVFVYLLLPETKNMPIEHMDRVWREHWFWKRIVGEGNE 454 >XP_012858638.1 PREDICTED: hexose carrier protein HEX6-like [Erythranthe guttata] EYU20201.1 hypothetical protein MIMGU_mgv1a005029mg [Erythranthe guttata] Length = 500 Score = 97.8 bits (242), Expect = 3e-21 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADR 152 SGIFFFFGGWVAVMTVF+YLLLPETKNIPIE+M+ VWREHWFWK V + Sbjct: 451 SGIFFFFGGWVAVMTVFVYLLLPETKNIPIEQMEMVWREHWFWKKFVVGK 500 >XP_019191596.1 PREDICTED: hexose carrier protein HEX6 isoform X2 [Ipomoea nil] Length = 498 Score = 97.4 bits (241), Expect = 4e-21 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 6 GIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIV 143 GIFFFFGGWVAVMT F+YLLLPETKN+PIEKMD VWREHWFWK IV Sbjct: 452 GIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV 497 >XP_019191595.1 PREDICTED: hexose carrier protein HEX6 isoform X1 [Ipomoea nil] Length = 498 Score = 97.4 bits (241), Expect = 4e-21 Identities = 41/46 (89%), Positives = 43/46 (93%) Frame = +3 Query: 6 GIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIV 143 GIFFFFGGWVAVMT F+YLLLPETKN+PIEKMD VWREHWFWK IV Sbjct: 452 GIFFFFGGWVAVMTTFVYLLLPETKNLPIEKMDLVWREHWFWKKIV 497 >XP_009362698.1 PREDICTED: hexose carrier protein HEX6-like [Pyrus x bretschneideri] Length = 509 Score = 97.4 bits (241), Expect = 5e-21 Identities = 40/52 (76%), Positives = 47/52 (90%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNK 158 +GIFFFFGGWVAVMTVF+YL LPETKN+PIEKM+ VW+EHWFW+ IV D +K Sbjct: 451 AGIFFFFGGWVAVMTVFVYLFLPETKNVPIEKMEIVWQEHWFWRRIVGDSSK 502 >XP_006385129.1 hypothetical protein POPTR_0004s24170g [Populus trichocarpa] ERP62926.1 hypothetical protein POPTR_0004s24170g [Populus trichocarpa] Length = 509 Score = 97.4 bits (241), Expect = 5e-21 Identities = 43/57 (75%), Positives = 49/57 (85%), Gaps = 3/57 (5%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVA---DRNKLE 164 SGIFFFFGGWVAVMT F+YLLLPETK +PIE MD+VWREHWFWK IV D++K+E Sbjct: 451 SGIFFFFGGWVAVMTAFVYLLLPETKKVPIEVMDRVWREHWFWKRIVEEFDDKSKME 507 >GAV75709.1 Sugar_tr domain-containing protein [Cephalotus follicularis] Length = 171 Score = 92.0 bits (227), Expect = 6e-21 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVAD 149 SG FFFFGGWV MTVF++ LLPETKN+PIEKM++VWREHWFWK+IV + Sbjct: 112 SGTFFFFGGWVVAMTVFVHYLLPETKNMPIEKMERVWREHWFWKNIVGE 160 >OMO98204.1 Sugar/inositol transporter [Corchorus olitorius] Length = 477 Score = 96.7 bits (239), Expect = 8e-21 Identities = 41/61 (67%), Positives = 52/61 (85%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNKLEGEDGMG 182 SGIFFFFGGWVAVMT+++Y LLPETKN+PIE+M++VWREHWFWK IV ++++ E G Sbjct: 419 SGIFFFFGGWVAVMTIYVYFLLPETKNVPIEQMEKVWREHWFWKRIVG--HQVDDEKGFT 476 Query: 183 S 185 S Sbjct: 477 S 477 >XP_008367298.1 PREDICTED: LOW QUALITY PROTEIN: hexose carrier protein HEX6-like [Malus domestica] Length = 508 Score = 96.7 bits (239), Expect = 8e-21 Identities = 39/49 (79%), Positives = 45/49 (91%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVAD 149 +GIFFFFGGWVAVMTVF+YL LPETKN+PIEKM+ VW+EHWFW+ IV D Sbjct: 450 AGIFFFFGGWVAVMTVFVYLFLPETKNVPIEKMESVWQEHWFWRRIVGD 498 >XP_009783890.1 PREDICTED: hexose carrier protein HEX6-like [Nicotiana sylvestris] XP_016466405.1 PREDICTED: hexose carrier protein HEX6-like [Nicotiana tabacum] Length = 509 Score = 96.7 bits (239), Expect = 9e-21 Identities = 38/54 (70%), Positives = 45/54 (83%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNKLE 164 SGIFFFFGGWVA+MT F+YLLLPET+N+PIE M+Q+WR+HWFWK V D E Sbjct: 452 SGIFFFFGGWVAIMTAFVYLLLPETRNLPIENMEQIWRDHWFWKRFVCDEQDYE 505 >XP_018721004.1 PREDICTED: hexose carrier protein HEX6 isoform X2 [Eucalyptus grandis] Length = 460 Score = 96.3 bits (238), Expect = 1e-20 Identities = 37/49 (75%), Positives = 46/49 (93%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVAD 149 SG+FFFFGGW A+MTVF++L LPETKN+PIE+MD++WREHWFWK IVA+ Sbjct: 402 SGLFFFFGGWAAIMTVFVHLFLPETKNVPIEQMDKIWREHWFWKKIVAE 450 >XP_008234428.1 PREDICTED: hexose carrier protein HEX6-like [Prunus mume] Length = 508 Score = 96.3 bits (238), Expect = 1e-20 Identities = 40/52 (76%), Positives = 46/52 (88%) Frame = +3 Query: 3 SGIFFFFGGWVAVMTVFIYLLLPETKNIPIEKMDQVWREHWFWKSIVADRNK 158 SGIFFFFGGWV+VMTVF+YL LPETKN+PIEKM+ VW EHWFW+ IV D +K Sbjct: 450 SGIFFFFGGWVSVMTVFVYLFLPETKNVPIEKMEMVWVEHWFWRRIVGDFSK 501