BLASTX nr result
ID: Magnolia22_contig00033046
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00033046 (404 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KXL44259.1 hypothetical protein FE78DRAFT_32805 [Acidomyces rich... 55 2e-06 >KXL44259.1 hypothetical protein FE78DRAFT_32805 [Acidomyces richmondensis] KYG44868.1 hypothetical protein M433DRAFT_135192 [Acidomyces richmondensis BFW] Length = 258 Score = 55.5 bits (132), Expect = 2e-06 Identities = 40/99 (40%), Positives = 51/99 (51%) Frame = -1 Query: 404 SRLELPAAPKTRHHHRSLTGGSASGSGHVSPPDLVRTPIGLKASALAGSGKRRSLSGTAS 225 SRL+LPA P R GG A S + PDLVRTP ++ + G+ SGTAS Sbjct: 157 SRLDLPAVPL-----RGARGGWAGRSSGTASPDLVRTPAAIRPPS---RGRTWHGSGTAS 208 Query: 224 PEGYFTMPFRGSMTALTTAGDRGSKAVSVVSFDDKDRRK 108 PEGYF +P G T+ DR S+ +SF +R K Sbjct: 209 PEGYFNVPLTG-----LTSVDRASR----LSFSRDERPK 238