BLASTX nr result
ID: Magnolia22_contig00032487
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032487 (528 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAM89392.1 hypothetical protein ANO11243_074290 [fungal sp. No.1... 64 5e-09 XP_018191772.1 hypothetical protein L228DRAFT_7863 [Xylona hevea... 64 7e-09 XP_018037155.1 meiotic expression up-regulated protein 14 [Parap... 62 5e-08 XP_007581171.1 putative sphingolipid long chain base-responsive ... 60 1e-07 XP_013346525.1 hypothetical protein AUEXF2481DRAFT_545257 [Aureo... 60 2e-07 OCL00780.1 hypothetical protein K441DRAFT_710166 [Cenococcum geo... 60 2e-07 KEQ63596.1 meiotic expression up-regulated protein 14 [Aureobasi... 60 2e-07 XP_007777816.1 hypothetical protein W97_01722 [Coniosporium apol... 59 4e-07 OBW68508.1 ZIP zinc/iron transport family [Aureobasidium pullulans] 59 5e-07 KEQ84013.1 meiotic expression up-regulated protein 14 [Aureobasi... 59 5e-07 XP_001937546.1 meiotic expression up-regulated protein 14 [Pyren... 59 5e-07 EHL01743.1 putative Sphingolipid long chain base-responsive prot... 59 5e-07 XP_008079134.1 meiotic expression up-regulated protein 14 [Glare... 59 5e-07 XP_003301680.1 hypothetical protein PTT_13242 [Pyrenophora teres... 59 7e-07 XP_003838026.1 hypothetical protein LEMA_P120730.1 [Leptosphaeri... 58 7e-07 KZM19702.1 hypothetical protein ST47_g9272 [Ascochyta rabiei] 58 1e-06 KKY22844.1 putative sphingolipid long chain base-responsive prot... 58 1e-06 OAL56606.1 hypothetical protein IQ07DRAFT_554681 [Pyrenochaeta s... 57 2e-06 OAL05975.1 hypothetical protein IQ06DRAFT_266452 [Stagonospora s... 57 2e-06 OCL10145.1 hypothetical protein AOQ84DRAFT_397010 [Glonium stell... 56 4e-06 >GAM89392.1 hypothetical protein ANO11243_074290 [fungal sp. No.11243] Length = 348 Score = 64.3 bits (155), Expect = 5e-09 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR AR+TGE VDL+ QD P+ NRESG+W+PAS+H Sbjct: 277 ARTLSQRRKARHTGEAVDLSGQDAPMEGNRESGMWVPASRH 317 >XP_018191772.1 hypothetical protein L228DRAFT_7863 [Xylona heveae TC161] KZF26217.1 hypothetical protein L228DRAFT_7863 [Xylona heveae TC161] Length = 291 Score = 63.5 bits (153), Expect = 7e-09 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR R GEGVDLASQDQPL ++RESGLW+PA QH Sbjct: 213 ARTLSQRRHQRREGEGVDLASQDQPL-KDRESGLWVPAEQH 252 >XP_018037155.1 meiotic expression up-regulated protein 14 [Paraphaeosphaeria sporulosa] OAG06790.1 meiotic expression up-regulated protein 14 [Paraphaeosphaeria sporulosa] Length = 348 Score = 61.6 bits (148), Expect = 5e-08 Identities = 30/41 (73%), Positives = 35/41 (85%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR + GEGVDL+ QDQPLG+ RESGLWIPAS+H Sbjct: 277 ARTLSQRRKNAHRGEGVDLSHQDQPLGD-RESGLWIPASEH 316 >XP_007581171.1 putative sphingolipid long chain base-responsive protein pil1 protein [Neofusicoccum parvum UCRNP2] EOD51363.1 putative sphingolipid long chain base-responsive protein pil1 protein [Neofusicoccum parvum UCRNP2] Length = 342 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/42 (76%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +3 Query: 3 SRTLSQRR-AARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR A R GEGVDL+ QDQPL E RESGLWIPAS+H Sbjct: 268 ARTLSQRRHARRQNGEGVDLSHQDQPL-EGRESGLWIPASEH 308 >XP_013346525.1 hypothetical protein AUEXF2481DRAFT_545257 [Aureobasidium subglaciale EXF-2481] KEQ97807.1 hypothetical protein AUEXF2481DRAFT_545257 [Aureobasidium subglaciale EXF-2481] Length = 349 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR R+ GE VDLA QD P+ NR+S LWIPASQH Sbjct: 277 TRTLSQRRRNRHQGEAVDLADQDAPMEGNRDSNLWIPASQH 317 >OCL00780.1 hypothetical protein K441DRAFT_710166 [Cenococcum geophilum 1.58] Length = 351 Score = 60.1 bits (144), Expect = 2e-07 Identities = 31/43 (72%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = +3 Query: 3 SRTLSQRR--AARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR A R GEG+DL+ QDQPL +NRESGLWIPAS+H Sbjct: 277 ARTLSQRRRNARREHGEGIDLSHQDQPL-DNRESGLWIPASEH 318 >KEQ63596.1 meiotic expression up-regulated protein 14 [Aureobasidium melanogenum CBS 110374] Length = 349 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR R+ GE VDLA QD P+ ++R+S LWIPASQH Sbjct: 277 TRTLSQRRRNRHQGEAVDLAGQDAPMEQSRDSNLWIPASQH 317 >XP_007777816.1 hypothetical protein W97_01722 [Coniosporium apollinis CBS 100218] EON62499.1 hypothetical protein W97_01722 [Coniosporium apollinis CBS 100218] Length = 350 Score = 58.9 bits (141), Expect = 4e-07 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +3 Query: 3 SRTLSQRR-AARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +R LSQRR A R+ GEGVDL+ QD P+ ENRESGLWIPASQH Sbjct: 277 ARQLSQRRKAGRHQGEGVDLSHQDAPM-ENRESGLWIPASQH 317 >OBW68508.1 ZIP zinc/iron transport family [Aureobasidium pullulans] Length = 348 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR R+ GE VDLA QD P+ ENR+S LWIPASQH Sbjct: 277 TRTLSQRRRNRHQGEAVDLAHQDAPM-ENRDSNLWIPASQH 316 >KEQ84013.1 meiotic expression up-regulated protein 14 [Aureobasidium pullulans EXF-150] Length = 348 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR R+ GE VDLA QD P+ ENR+S LWIPASQH Sbjct: 277 TRTLSQRRRNRHQGEAVDLAHQDAPM-ENRDSNLWIPASQH 316 >XP_001937546.1 meiotic expression up-regulated protein 14 [Pyrenophora tritici-repentis Pt-1C-BFP] EDU50133.1 meiotic expression up-regulated protein 14 [Pyrenophora tritici-repentis Pt-1C-BFP] Length = 349 Score = 58.5 bits (140), Expect = 5e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 SRTLSQRR RN EGVDL+ QDQ L +RESGLWIPAS+H Sbjct: 277 SRTLSQRRRNRNHSEGVDLSGQDQAL--DRESGLWIPASEH 315 >EHL01743.1 putative Sphingolipid long chain base-responsive protein PIL1 [Glarea lozoyensis 74030] Length = 350 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 SR LSQRR A+ +GEG DL+ QDQPL + RESGLWIPAS H Sbjct: 271 SRNLSQRRRAQRSGEGHDLSGQDQPLND-RESGLWIPASAH 310 >XP_008079134.1 meiotic expression up-regulated protein 14 [Glarea lozoyensis ATCC 20868] EPE33982.1 meiotic expression up-regulated protein 14 [Glarea lozoyensis ATCC 20868] Length = 356 Score = 58.5 bits (140), Expect = 5e-07 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 SR LSQRR A+ +GEG DL+ QDQPL + RESGLWIPAS H Sbjct: 277 SRNLSQRRRAQRSGEGHDLSGQDQPLND-RESGLWIPASAH 316 >XP_003301680.1 hypothetical protein PTT_13242 [Pyrenophora teres f. teres 0-1] EFQ90232.1 hypothetical protein PTT_13242 [Pyrenophora teres f. teres 0-1] Length = 721 Score = 58.5 bits (140), Expect = 7e-07 Identities = 30/41 (73%), Positives = 33/41 (80%) Frame = +3 Query: 3 SRTLSQRRAARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 SRTLSQRR RN EGVDL+ QDQ L +RESGLWIPAS+H Sbjct: 649 SRTLSQRRRNRNHSEGVDLSGQDQAL--DRESGLWIPASEH 687 >XP_003838026.1 hypothetical protein LEMA_P120730.1 [Leptosphaeria maculans JN3] CBX94582.1 hypothetical protein LEMA_P120730.1 [Leptosphaeria maculans JN3] Length = 337 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/43 (74%), Positives = 34/43 (79%), Gaps = 2/43 (4%) Frame = +3 Query: 3 SRTLSQRRAA--RNTGEGVDLASQDQPLGENRESGLWIPASQH 125 SRTLSQRR RN GEGVDL+ QDQ L E RESGLWIPAS+H Sbjct: 263 SRTLSQRRRNQNRNRGEGVDLSGQDQEL-EGRESGLWIPASEH 304 >KZM19702.1 hypothetical protein ST47_g9272 [Ascochyta rabiei] Length = 349 Score = 57.8 bits (138), Expect = 1e-06 Identities = 31/43 (72%), Positives = 36/43 (83%), Gaps = 2/43 (4%) Frame = +3 Query: 3 SRTLSQRRAARN--TGEGVDLASQDQPLGENRESGLWIPASQH 125 SRTLSQRR R+ TGE VDL+ QDQPL ++RESGLWIPAS+H Sbjct: 277 SRTLSQRRRNRSQHTGEPVDLSGQDQPL-DSRESGLWIPASEH 318 >KKY22844.1 putative sphingolipid long chain base-responsive protein pil1 [Diplodia seriata] OMP86844.1 Sphingolipid long chain base-responsive protein PIL1 [Diplodia seriata] Length = 349 Score = 57.8 bits (138), Expect = 1e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +3 Query: 3 SRTLSQRR-AARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +RTLSQRR R GEGVDL+ QDQP+ E RESGLWIPAS+H Sbjct: 277 ARTLSQRRHQRRQNGEGVDLSHQDQPM-EGRESGLWIPASEH 317 >OAL56606.1 hypothetical protein IQ07DRAFT_554681 [Pyrenochaeta sp. DS3sAY3a] Length = 729 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +3 Query: 3 SRTLSQRRAAR-NTGEGVDLASQDQPLGENRESGLWIPASQH 125 SRTLSQRR + GEGVDL+ QDQPL ++RESGLWIPAS+H Sbjct: 655 SRTLSQRRRNQARRGEGVDLSGQDQPL-DSRESGLWIPASEH 695 >OAL05975.1 hypothetical protein IQ06DRAFT_266452 [Stagonospora sp. SRC1lsM3a] Length = 730 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/42 (71%), Positives = 34/42 (80%), Gaps = 1/42 (2%) Frame = +3 Query: 3 SRTLSQRRA-ARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 SRTLSQRR A G+GVDL+ QDQPL + RESGLWIPAS+H Sbjct: 655 SRTLSQRRRNATRRGDGVDLSGQDQPL-DGRESGLWIPASEH 695 >OCL10145.1 hypothetical protein AOQ84DRAFT_397010 [Glonium stellatum] Length = 660 Score = 56.2 bits (134), Expect = 4e-06 Identities = 29/43 (67%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +3 Query: 3 SRTLSQRR--AARNTGEGVDLASQDQPLGENRESGLWIPASQH 125 +R LSQRR A R GEG+DL+ QDQPL ++RESGLWIPAS+H Sbjct: 587 ARNLSQRRRNARREHGEGIDLSHQDQPL-DSRESGLWIPASEH 628