BLASTX nr result
ID: Magnolia22_contig00032385
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032385 (319 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016259993.1 hypothetical protein PV06_08362 [Exophiala oligos... 51 3e-06 XP_007725874.1 hypothetical protein A1O1_06807 [Capronia coronat... 50 4e-06 XP_013278253.1 hypothetical protein Z517_12385 [Fonsecaea pedros... 50 6e-06 >XP_016259993.1 hypothetical protein PV06_08362 [Exophiala oligosperma] KIW39777.1 hypothetical protein PV06_08362 [Exophiala oligosperma] Length = 71 Score = 50.8 bits (120), Expect = 3e-06 Identities = 23/40 (57%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 9 MKNNKESREISERKQVGDAESMMN-EPAINMPGSGSEWLD 125 M++ +REISERKQVGD ESM+N EP + +PG S+WL+ Sbjct: 32 MRSRSRNREISERKQVGDTESMINEEPNVVLPGGASQWLE 71 >XP_007725874.1 hypothetical protein A1O1_06807 [Capronia coronata CBS 617.96] EXJ83188.1 hypothetical protein A1O1_06807 [Capronia coronata CBS 617.96] Length = 73 Score = 50.4 bits (119), Expect = 4e-06 Identities = 23/40 (57%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 9 MKNNKESREISERKQVGDAESMMN-EPAINMPGSGSEWLD 125 +++ +RE+SERKQVGDAESM+N EP + PG SEWL+ Sbjct: 34 VRSRLRNREVSERKQVGDAESMINEEPNVMQPGGASEWLE 73 >XP_013278253.1 hypothetical protein Z517_12385 [Fonsecaea pedrosoi CBS 271.37] KIW74445.1 hypothetical protein Z517_12385 [Fonsecaea pedrosoi CBS 271.37] Length = 77 Score = 50.1 bits (118), Expect = 6e-06 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 1/40 (2%) Frame = +3 Query: 9 MKNNKESREISERKQVGDAESMMN-EPAINMPGSGSEWLD 125 +++ SRE++ERKQVGDAESM+N EP++ PG S+WL+ Sbjct: 38 VRSRLRSREVTERKQVGDAESMINEEPSVVQPGGASQWLE 77