BLASTX nr result
ID: Magnolia22_contig00032168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032168 (811 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIV77205.1 hypothetical protein PV11_09022 [Exophiala sideris] 87 5e-18 XP_016262446.1 hypothetical protein PV06_05794 [Exophiala oligos... 85 2e-17 XP_016626280.1 hypothetical protein Z520_12150 [Fonsecaea multim... 83 1e-16 XP_016618963.1 hypothetical protein Z519_07278 [Cladophialophora... 83 1e-16 XP_007741549.1 hypothetical protein A1O5_02745 [Cladophialophora... 83 1e-16 XP_016242975.1 hypothetical protein PV07_11025 [Cladophialophora... 80 9e-16 XP_013286996.1 hypothetical protein Z517_02433 [Fonsecaea pedros... 78 6e-15 OJJ62189.1 hypothetical protein ASPSYDRAFT_55107 [Aspergillus sy... 72 1e-12 OJI96298.1 hypothetical protein ASPVEDRAFT_120937 [Aspergillus v... 72 1e-12 XP_003189207.1 hypothetical protein AOR_1_1372174 [Aspergillus o... 71 2e-12 OOF97353.1 hypothetical protein ASPCADRAFT_395586 [Aspergillus c... 71 2e-12 XP_003188533.1 hypothetical protein ANI_1_654014 [Aspergillus ni... 71 2e-12 XP_001269837.1 conserved hypothetical protein [Aspergillus clava... 71 2e-12 KKZ62206.1 hypothetical protein EMCG_03344 [Emmonsia crescens UA... 69 2e-11 CBF89817.1 TPA: hypothetical protein ANIA_10050 [Aspergillus nid... 68 2e-11 OJJ47904.1 hypothetical protein ASPZODRAFT_131507 [Penicilliopsi... 68 3e-11 EYE93606.1 hypothetical protein EURHEDRAFT_459480 [Aspergillus r... 65 2e-10 EPS28089.1 hypothetical protein PDE_03035 [Penicillium oxalicum ... 65 2e-10 KOC12962.1 hypothetical protein AFLA70_34g003820, partial [Asper... 64 9e-10 OJD11323.1 hypothetical protein ACJ73_09567, partial [Blastomyce... 64 2e-09 >KIV77205.1 hypothetical protein PV11_09022 [Exophiala sideris] Length = 101 Score = 86.7 bits (213), Expect = 5e-18 Identities = 47/94 (50%), Positives = 60/94 (63%), Gaps = 2/94 (2%) Frame = +2 Query: 47 SPSLLQLQTQAGYGTQPIAIEN-TKARSDXXXXXXXXXXXXXXXXXXXDIVRCSRCQRSM 223 SPS+LQLQTQA G +PI + + +K+ DIVRCSRCQRS+ Sbjct: 4 SPSILQLQTQAATGARPIKMPSMSKSNHSDDSINTISRSASASPKASLDIVRCSRCQRSL 63 Query: 224 TLDPTSSSN-SGVVRFGLNSYYCSRCANHVGFVK 322 ++D +S + SGVVRFG+NSYYC+RCAN VGF K Sbjct: 64 SIDTSSHAGPSGVVRFGVNSYYCTRCANAVGFGK 97 >XP_016262446.1 hypothetical protein PV06_05794 [Exophiala oligosperma] KIW42230.1 hypothetical protein PV06_05794 [Exophiala oligosperma] Length = 100 Score = 85.1 bits (209), Expect = 2e-17 Identities = 47/97 (48%), Positives = 58/97 (59%), Gaps = 5/97 (5%) Frame = +2 Query: 47 SPSLLQLQTQAGYGTQPIAIENTKAR----SDXXXXXXXXXXXXXXXXXXXDIVRCSRCQ 214 S S+LQLQ+Q G +PI ++N +R D DIVRCSRCQ Sbjct: 4 SSSILQLQSQVASGARPIPLKNPHSRPNRSDDSISTISSNSSASASPKPSLDIVRCSRCQ 63 Query: 215 RSMTLDPT-SSSNSGVVRFGLNSYYCSRCANHVGFVK 322 RS+++D + +SG VRFGLNSYYCSRCAN VGFVK Sbjct: 64 RSLSIDTSLPREHSGAVRFGLNSYYCSRCANVVGFVK 100 >XP_016626280.1 hypothetical protein Z520_12150 [Fonsecaea multimorphosa CBS 102226] KIX92157.1 hypothetical protein Z520_12150 [Fonsecaea multimorphosa CBS 102226] Length = 97 Score = 82.8 bits (203), Expect = 1e-16 Identities = 46/92 (50%), Positives = 56/92 (60%), Gaps = 1/92 (1%) Frame = +2 Query: 50 PSLLQLQTQAGYGTQPIAIENTKARSDXXXXXXXXXXXXXXXXXXXDIVRCSRCQRSMTL 229 PS+LQLQT A G++P I RSD DIVRCSRCQRS+++ Sbjct: 7 PSILQLQTLAANGSKPTKITPKANRSDDSINTLSSSASASPKSSL-DIVRCSRCQRSLSI 65 Query: 230 DPT-SSSNSGVVRFGLNSYYCSRCANHVGFVK 322 D + + +SG VRFG+NSYYC RCAN VGFVK Sbjct: 66 DTSLPAQSSGAVRFGMNSYYCQRCANVVGFVK 97 >XP_016618963.1 hypothetical protein Z519_07278 [Cladophialophora bantiana CBS 173.52] KIW92294.1 hypothetical protein Z519_07278 [Cladophialophora bantiana CBS 173.52] Length = 97 Score = 82.8 bits (203), Expect = 1e-16 Identities = 45/93 (48%), Positives = 56/93 (60%), Gaps = 1/93 (1%) Frame = +2 Query: 47 SPSLLQLQTQAGYGTQPIAIENTKARSDXXXXXXXXXXXXXXXXXXXDIVRCSRCQRSMT 226 +PS+LQLQT A G++P I KA DIVRCSRCQRS++ Sbjct: 6 TPSILQLQTLAANGSKPTKI-TPKANKSDDSISTLSSSASASPKTSLDIVRCSRCQRSLS 64 Query: 227 LDPT-SSSNSGVVRFGLNSYYCSRCANHVGFVK 322 +D + + +SG VRFG+NSYYC RCAN VGFVK Sbjct: 65 IDTSLPAQSSGAVRFGMNSYYCQRCANVVGFVK 97 >XP_007741549.1 hypothetical protein A1O5_02745 [Cladophialophora psammophila CBS 110553] EXJ74449.1 hypothetical protein A1O5_02745 [Cladophialophora psammophila CBS 110553] Length = 97 Score = 82.8 bits (203), Expect = 1e-16 Identities = 45/93 (48%), Positives = 56/93 (60%), Gaps = 1/93 (1%) Frame = +2 Query: 47 SPSLLQLQTQAGYGTQPIAIENTKARSDXXXXXXXXXXXXXXXXXXXDIVRCSRCQRSMT 226 +PS+LQLQT A G++P I KA DIVRCSRCQRS++ Sbjct: 6 TPSILQLQTLAANGSKPTKI-TPKANKSDDSISTVSSSASASPKTSLDIVRCSRCQRSLS 64 Query: 227 LDPT-SSSNSGVVRFGLNSYYCSRCANHVGFVK 322 +D + + +SG VRFG+NSYYC RCAN VGFVK Sbjct: 65 IDTSLPAQSSGAVRFGMNSYYCQRCANVVGFVK 97 >XP_016242975.1 hypothetical protein PV07_11025 [Cladophialophora immunda] KIW22759.1 hypothetical protein PV07_11025 [Cladophialophora immunda] Length = 97 Score = 80.5 bits (197), Expect = 9e-16 Identities = 45/92 (48%), Positives = 55/92 (59%), Gaps = 1/92 (1%) Frame = +2 Query: 50 PSLLQLQTQAGYGTQPIAIENTKARSDXXXXXXXXXXXXXXXXXXXDIVRCSRCQRSMTL 229 PS+LQLQT A G++P I +SD DIVRCSRCQRS+++ Sbjct: 7 PSILQLQTLAANGSKPTKITPKTNKSDDSINTLSSSASASPKTSL-DIVRCSRCQRSLSI 65 Query: 230 DPTSSSN-SGVVRFGLNSYYCSRCANHVGFVK 322 D + + SG VRFG+NSYYC RCAN VGFVK Sbjct: 66 DTSLPAQCSGAVRFGMNSYYCQRCANVVGFVK 97 >XP_013286996.1 hypothetical protein Z517_02433 [Fonsecaea pedrosoi CBS 271.37] KIW83188.1 hypothetical protein Z517_02433 [Fonsecaea pedrosoi CBS 271.37] Length = 97 Score = 78.2 bits (191), Expect = 6e-15 Identities = 45/91 (49%), Positives = 53/91 (58%), Gaps = 1/91 (1%) Frame = +2 Query: 53 SLLQLQTQAGYGTQPIAIENTKARSDXXXXXXXXXXXXXXXXXXXDIVRCSRCQRSMTLD 232 SLLQLQT A G+ I +SD DIVRCSRCQRS+++D Sbjct: 8 SLLQLQTLAANGSNATKIGPKSNKSDDSINTLSSSASGSPKSSL-DIVRCSRCQRSLSID 66 Query: 233 PT-SSSNSGVVRFGLNSYYCSRCANHVGFVK 322 + + NSG VRFG+NSYYC RCAN VGFVK Sbjct: 67 TSLPAQNSGAVRFGMNSYYCQRCANVVGFVK 97 >OJJ62189.1 hypothetical protein ASPSYDRAFT_55107 [Aspergillus sydowii CBS 593.65] Length = 74 Score = 71.6 bits (174), Expect = 1e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQRSM+L+ S S GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 32 DIVRCSRCQRSMSLE--SESTPGVVRFGMNSYYCSRCASMVGFIR 74 >OJI96298.1 hypothetical protein ASPVEDRAFT_120937 [Aspergillus versicolor CBS 583.65] Length = 74 Score = 71.6 bits (174), Expect = 1e-12 Identities = 33/45 (73%), Positives = 39/45 (86%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQRSM+L+ S S GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 32 DIVRCSRCQRSMSLE--SESTPGVVRFGMNSYYCSRCASMVGFIR 74 >XP_003189207.1 hypothetical protein AOR_1_1372174 [Aspergillus oryzae RIB40] Length = 74 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQRSM+L+ + S+ GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 32 DIVRCSRCQRSMSLE--NDSSPGVVRFGMNSYYCSRCASMVGFIR 74 >OOF97353.1 hypothetical protein ASPCADRAFT_395586 [Aspergillus carbonarius ITEM 5010] Length = 75 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQRSM+L+ + S+ GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 33 DIVRCSRCQRSMSLE--NESSPGVVRFGMNSYYCSRCASMVGFIR 75 >XP_003188533.1 hypothetical protein ANI_1_654014 [Aspergillus niger CBS 513.88] OJJ74961.1 hypothetical protein ASPBRDRAFT_52939 [Aspergillus brasiliensis CBS 101740] Length = 75 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQRSM+L+ + S+ GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 33 DIVRCSRCQRSMSLE--NESSPGVVRFGMNSYYCSRCASMVGFIR 75 >XP_001269837.1 conserved hypothetical protein [Aspergillus clavatus NRRL 1] EAW08411.1 conserved hypothetical protein [Aspergillus clavatus NRRL 1] Length = 76 Score = 70.9 bits (172), Expect = 2e-12 Identities = 32/45 (71%), Positives = 40/45 (88%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQRSM+L+ + S+ GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 34 DIVRCSRCQRSMSLE--NESSPGVVRFGMNSYYCSRCASMVGFIR 76 >KKZ62206.1 hypothetical protein EMCG_03344 [Emmonsia crescens UAMH 3008] Length = 80 Score = 68.6 bits (166), Expect = 2e-11 Identities = 33/43 (76%), Positives = 37/43 (86%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGF 316 DIVRCSRCQRS+ L+ SSS GVVRFG+NSYYCSRCA+ VGF Sbjct: 37 DIVRCSRCQRSLCLEHASSS-PGVVRFGVNSYYCSRCASMVGF 78 >CBF89817.1 TPA: hypothetical protein ANIA_10050 [Aspergillus nidulans FGSC A4] Length = 75 Score = 68.2 bits (165), Expect = 2e-11 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DI+RCSRCQ+S++++ S S GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 33 DIIRCSRCQKSLSIE--SDSTPGVVRFGMNSYYCSRCASMVGFIR 75 >OJJ47904.1 hypothetical protein ASPZODRAFT_131507 [Penicilliopsis zonata CBS 506.65] Length = 76 Score = 67.8 bits (164), Expect = 3e-11 Identities = 32/45 (71%), Positives = 38/45 (84%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQ S++LD SS GVVRFG+NSYYCSRCA+ VGF++ Sbjct: 34 DIVRCSRCQCSLSLDHPSSP--GVVRFGMNSYYCSRCASMVGFIR 76 >EYE93606.1 hypothetical protein EURHEDRAFT_459480 [Aspergillus ruber CBS 135680] OJJ86691.1 hypothetical protein ASPGLDRAFT_44536 [Aspergillus glaucus CBS 516.65] Length = 69 Score = 65.5 bits (158), Expect = 2e-10 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGF 316 DIVRCSRCQRSM+L+ + GVVRFG+NSYYCSRCA+ VG+ Sbjct: 26 DIVRCSRCQRSMSLEKDEKT-PGVVRFGMNSYYCSRCASMVGY 67 >EPS28089.1 hypothetical protein PDE_03035 [Penicillium oxalicum 114-2] Length = 72 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCANHVGFVK 322 DIVRCSRCQ+S++L + S+ SGVV+FG+NSYYC RCA+ VGF++ Sbjct: 29 DIVRCSRCQQSLSL-ASQSTGSGVVQFGMNSYYCHRCASKVGFLR 72 >KOC12962.1 hypothetical protein AFLA70_34g003820, partial [Aspergillus flavus AF70] Length = 69 Score = 63.5 bits (153), Expect = 9e-10 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCAN 304 DIVRCSRCQRSM+L+ + S+ GVVRFG+NSYYCSRCA+ Sbjct: 32 DIVRCSRCQRSMSLE--NDSSPGVVRFGMNSYYCSRCAS 68 >OJD11323.1 hypothetical protein ACJ73_09567, partial [Blastomyces sp. CAC-2015b] Length = 95 Score = 63.5 bits (153), Expect = 2e-09 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = +2 Query: 188 DIVRCSRCQRSMTLDPTSSSNSGVVRFGLNSYYCSRCAN 304 DIVRCSRCQRS+ L+ +SSS GVVRFG+NSYYCSRCA+ Sbjct: 57 DIVRCSRCQRSLCLEHSSSS-PGVVRFGVNSYYCSRCAS 94