BLASTX nr result
ID: Magnolia22_contig00032108
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032108 (313 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016625398.1 hypothetical protein Z519_00392 [Cladophialophora... 83 2e-17 XP_007739199.1 hypothetical protein A1O5_00390 [Cladophialophora... 83 2e-17 XP_013267597.1 hypothetical protein Z518_10601 [Rhinocladiella m... 82 3e-17 XP_018695478.1 hypothetical protein AYL99_04314 [Fonsecaea erect... 82 3e-17 XP_016250456.1 hypothetical protein PV07_05998 [Cladophialophora... 82 4e-17 XP_016627918.1 hypothetical protein Z520_10420 [Fonsecaea multim... 82 4e-17 OAL23954.1 hypothetical protein AYO20_10804 [Fonsecaea nubica] 81 1e-16 OAG42100.1 hypothetical protein AYO21_03554 [Fonsecaea monophora] 81 1e-16 XP_013284250.1 hypothetical protein Z517_07058 [Fonsecaea pedros... 81 1e-16 XP_007720153.1 hypothetical protein A1O1_01049 [Capronia coronat... 80 2e-16 XP_007735998.1 hypothetical protein A1O3_07702 [Capronia epimyce... 80 2e-16 XP_009152827.1 hypothetical protein HMPREF1120_00580 [Exophiala ... 79 5e-16 OCT54395.1 60S ribosomal protein L25 [Cladophialophora carrionii] 79 9e-16 XP_008723283.1 hypothetical protein G647_01662 [Cladophialophora... 79 9e-16 KIV78127.1 hypothetical protein PV11_09875 [Exophiala sideris] 78 1e-15 XP_013265842.1 hypothetical protein A1O9_01229 [Exophiala aquama... 77 3e-15 KIW72183.1 hypothetical protein PV04_00398 [Capronia semi-immersa] 77 3e-15 XP_008719128.1 hypothetical protein HMPREF1541_06575 [Cyphelloph... 78 4e-15 XP_013322537.1 hypothetical protein PV05_02013 [Exophiala xenobi... 77 5e-15 XP_016225799.1 hypothetical protein PV10_02012 [Exophiala mesoph... 77 5e-15 >XP_016625398.1 hypothetical protein Z519_00392 [Cladophialophora bantiana CBS 173.52] KIW98729.1 hypothetical protein Z519_00392 [Cladophialophora bantiana CBS 173.52] Length = 227 Score = 83.2 bits (204), Expect = 2e-17 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER+MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 183 VKGHKWERQMGATLEKRRKAMESMPELIREWKQKGHGRGWKKYPK 227 >XP_007739199.1 hypothetical protein A1O5_00390 [Cladophialophora psammophila CBS 110553] EXJ75882.1 hypothetical protein A1O5_00390 [Cladophialophora psammophila CBS 110553] Length = 227 Score = 83.2 bits (204), Expect = 2e-17 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER+MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 183 VKGHKWERQMGATLEKRRKAMESMPELIREWKQKGHGRGWKKYPK 227 >XP_013267597.1 hypothetical protein Z518_10601 [Rhinocladiella mackenziei CBS 650.93] KIX00461.1 hypothetical protein Z518_10601 [Rhinocladiella mackenziei CBS 650.93] Length = 209 Score = 82.4 bits (202), Expect = 3e-17 Identities = 33/45 (73%), Positives = 40/45 (88%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER++G L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 165 VKGHKWERQLGATLEKRRQAMENMPELIREWKQKGHGRGWKKYPK 209 >XP_018695478.1 hypothetical protein AYL99_04314 [Fonsecaea erecta] OAP62111.1 hypothetical protein AYL99_04314 [Fonsecaea erecta] Length = 223 Score = 82.4 bits (202), Expect = 3e-17 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 179 VKGHKWERHMGATLEKRRKAMESMPELIREWKQKGHGRGWKKYPK 223 >XP_016250456.1 hypothetical protein PV07_05998 [Cladophialophora immunda] KIW30240.1 hypothetical protein PV07_05998 [Cladophialophora immunda] Length = 227 Score = 82.4 bits (202), Expect = 4e-17 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 183 VKGHKWERRMGATLEKRKKAMESMPELIREWKQKGHGRGWKKYPK 227 >XP_016627918.1 hypothetical protein Z520_10420 [Fonsecaea multimorphosa CBS 102226] KIX93795.1 hypothetical protein Z520_10420 [Fonsecaea multimorphosa CBS 102226] OAL19224.1 hypothetical protein AYO22_09985 [Fonsecaea multimorphosa] Length = 229 Score = 82.4 bits (202), Expect = 4e-17 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 185 VKGHKWERHMGATLEKRRKAMESMPELIREWKQKGHGRGWKKYPK 229 >OAL23954.1 hypothetical protein AYO20_10804 [Fonsecaea nubica] Length = 232 Score = 81.3 bits (199), Expect = 1e-16 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 188 VKGHKWERHMGATLEKRRKAMEGMPDLIREWKQKGHGRGWKKYPK 232 >OAG42100.1 hypothetical protein AYO21_03554 [Fonsecaea monophora] Length = 232 Score = 81.3 bits (199), Expect = 1e-16 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 188 VKGHKWERHMGATLEKRRKAMEGMPDLIREWKQKGHGRGWKKYPK 232 >XP_013284250.1 hypothetical protein Z517_07058 [Fonsecaea pedrosoi CBS 271.37] KIW80442.1 hypothetical protein Z517_07058 [Fonsecaea pedrosoi CBS 271.37] Length = 232 Score = 81.3 bits (199), Expect = 1e-16 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER MG L+KR +AME MP L+REWKQ+G+GRGWKKYPK Sbjct: 188 VKGHKWERHMGATLEKRRKAMEGMPDLIREWKQKGHGRGWKKYPK 232 >XP_007720153.1 hypothetical protein A1O1_01049 [Capronia coronata CBS 617.96] EXJ95924.1 hypothetical protein A1O1_01049 [Capronia coronata CBS 617.96] Length = 219 Score = 80.5 bits (197), Expect = 2e-16 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER +G L KR AME MP LVREWKQRG+GRGWKKYPK Sbjct: 175 VKGHKWERHVGANLDKRRTAMENMPELVREWKQRGHGRGWKKYPK 219 >XP_007735998.1 hypothetical protein A1O3_07702 [Capronia epimyces CBS 606.96] EXJ81410.1 hypothetical protein A1O3_07702 [Capronia epimyces CBS 606.96] Length = 216 Score = 80.1 bits (196), Expect = 2e-16 Identities = 35/45 (77%), Positives = 37/45 (82%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER +G L KR AME MP LVREWKQRG+GRGWKKYPK Sbjct: 172 VKGHKWERRVGANLDKRRTAMENMPDLVREWKQRGHGRGWKKYPK 216 >XP_009152827.1 hypothetical protein HMPREF1120_00580 [Exophiala dermatitidis NIH/UT8656] EHY52366.1 hypothetical protein HMPREF1120_00580 [Exophiala dermatitidis NIH/UT8656] Length = 225 Score = 79.3 bits (194), Expect = 5e-16 Identities = 33/45 (73%), Positives = 37/45 (82%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER +G L KR AME MP ++REWKQRG+GRGWKKYPK Sbjct: 181 VKGHKWERHVGANLDKRRAAMENMPEMIREWKQRGHGRGWKKYPK 225 >OCT54395.1 60S ribosomal protein L25 [Cladophialophora carrionii] Length = 234 Score = 79.0 bits (193), Expect = 9e-16 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYP 177 VKGHKWER MG L+KR +AME MPAL+REWKQ+G+GRGW KYP Sbjct: 184 VKGHKWERRMGTTLEKRRKAMENMPALIREWKQKGHGRGWGKYP 227 >XP_008723283.1 hypothetical protein G647_01662 [Cladophialophora carrionii CBS 160.54] ETI29209.1 hypothetical protein G647_01662 [Cladophialophora carrionii CBS 160.54] Length = 234 Score = 79.0 bits (193), Expect = 9e-16 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYP 177 VKGHKWER MG L+KR +AME MPAL+REWKQ+G+GRGW KYP Sbjct: 184 VKGHKWERRMGTTLEKRRKAMENMPALIREWKQKGHGRGWGKYP 227 >KIV78127.1 hypothetical protein PV11_09875 [Exophiala sideris] Length = 210 Score = 78.2 bits (191), Expect = 1e-15 Identities = 33/45 (73%), Positives = 38/45 (84%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER +G L+KR AME MP LV+EWK+RG+GRGWKKYPK Sbjct: 166 VKGHKWERHIGANLEKRRTAMENMPELVQEWKRRGHGRGWKKYPK 210 >XP_013265842.1 hypothetical protein A1O9_01229 [Exophiala aquamarina CBS 119918] KEF63252.1 hypothetical protein A1O9_01229 [Exophiala aquamarina CBS 119918] Length = 225 Score = 77.4 bits (189), Expect = 3e-15 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER MG L KR +AME MPAL+REW+ +G+GRGW KYPK Sbjct: 178 VKGHKWERTMGTRLDKRRQAMENMPALIREWESKGHGRGWSKYPK 222 >KIW72183.1 hypothetical protein PV04_00398 [Capronia semi-immersa] Length = 234 Score = 77.4 bits (189), Expect = 3e-15 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYP 177 VKGHKWER +G L KR +AME MPAL+REWKQ+G+GRGW KYP Sbjct: 184 VKGHKWERRIGTTLDKRRKAMENMPALIREWKQKGHGRGWSKYP 227 >XP_008719128.1 hypothetical protein HMPREF1541_06575 [Cyphellophora europaea CBS 101466] ETN38539.1 hypothetical protein HMPREF1541_06575 [Cyphellophora europaea CBS 101466] Length = 260 Score = 77.8 bits (190), Expect = 4e-15 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGH+WER++ +LQKR EA+E+MPALVREW+ RG+GRGWKK+PK Sbjct: 211 VKGHQWERKIPALLQKRQEALEQMPALVREWQARGHGRGWKKFPK 255 >XP_013322537.1 hypothetical protein PV05_02013 [Exophiala xenobiotica] KIW61953.1 hypothetical protein PV05_02013 [Exophiala xenobiotica] Length = 211 Score = 76.6 bits (187), Expect = 5e-15 Identities = 32/45 (71%), Positives = 37/45 (82%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGH WER +G L+KR AME MP LV+EWK+RG+GRGWKKYPK Sbjct: 167 VKGHAWERHVGATLEKRRTAMENMPELVKEWKRRGHGRGWKKYPK 211 >XP_016225799.1 hypothetical protein PV10_02012 [Exophiala mesophila] KIV94225.1 hypothetical protein PV10_02012 [Exophiala mesophila] Length = 221 Score = 76.6 bits (187), Expect = 5e-15 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -3 Query: 308 VKGHKWEREMGGMLQKRIEAMEKMPALVREWKQRGNGRGWKKYPK 174 VKGHKWER G L+KR +AME MPAL+ EWK +G+GRGWKK+PK Sbjct: 174 VKGHKWERTQGARLEKRRQAMENMPALISEWKSKGHGRGWKKFPK 218