BLASTX nr result
ID: Magnolia22_contig00032043
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00032043 (349 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013310914.1 hypothetical protein PV05_11927 [Exophiala xenobi... 57 3e-07 XP_016265054.1 hypothetical protein PV06_03281 [Exophiala oligos... 56 5e-07 XP_016235728.1 hypothetical protein PV08_05558 [Exophiala spinif... 56 6e-07 XP_013273678.1 hypothetical protein Z518_04518 [Rhinocladiella m... 54 2e-06 >XP_013310914.1 hypothetical protein PV05_11927 [Exophiala xenobiotica] KIW50330.1 hypothetical protein PV05_11927 [Exophiala xenobiotica] Length = 256 Score = 57.0 bits (136), Expect = 3e-07 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 258 CPQYTATAPPAWFSQLPTSVLSSLAAQWTG 347 CP YTAT PPAWFS LPTSV+SS++A WTG Sbjct: 127 CPSYTATTPPAWFSLLPTSVISSISAAWTG 156 >XP_016265054.1 hypothetical protein PV06_03281 [Exophiala oligosperma] KIW44838.1 hypothetical protein PV06_03281 [Exophiala oligosperma] Length = 251 Score = 56.2 bits (134), Expect = 5e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 258 CPQYTATAPPAWFSQLPTSVLSSLAAQWTG 347 CP YTAT PPAWFS LPT VLSS++A WTG Sbjct: 124 CPSYTATTPPAWFSLLPTEVLSSISAAWTG 153 >XP_016235728.1 hypothetical protein PV08_05558 [Exophiala spinifera] KIW15512.1 hypothetical protein PV08_05558 [Exophiala spinifera] Length = 245 Score = 55.8 bits (133), Expect = 6e-07 Identities = 23/30 (76%), Positives = 24/30 (80%) Frame = +3 Query: 258 CPQYTATAPPAWFSQLPTSVLSSLAAQWTG 347 CP YTAT PPAWFS LPT VLSS+ A WTG Sbjct: 123 CPSYTATTPPAWFSLLPTEVLSSIEASWTG 152 >XP_013273678.1 hypothetical protein Z518_04518 [Rhinocladiella mackenziei CBS 650.93] KIX06542.1 hypothetical protein Z518_04518 [Rhinocladiella mackenziei CBS 650.93] Length = 244 Score = 54.3 bits (129), Expect = 2e-06 Identities = 23/30 (76%), Positives = 26/30 (86%) Frame = +3 Query: 258 CPQYTATAPPAWFSQLPTSVLSSLAAQWTG 347 C YTATAPPAWFS LP+SVLSS+ A+WTG Sbjct: 127 CGSYTATAPPAWFSLLPSSVLSSIEAKWTG 156