BLASTX nr result
ID: Magnolia22_contig00030952
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00030952 (415 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010942742.1 PREDICTED: DNA-directed RNA polymerases II, IV an... 51 7e-06 >XP_010942742.1 PREDICTED: DNA-directed RNA polymerases II, IV and V subunit 8B [Elaeis guineensis] Length = 145 Score = 51.2 bits (121), Expect(2) = 7e-06 Identities = 25/44 (56%), Positives = 33/44 (75%) Frame = +3 Query: 213 GMNAKSLTKIGARSEQFNMYMRLDVNIELCLLNVREKFVMVLAP 344 G +++I ARSEQF+MYM+LDVN E+ L+V +KF MVLAP Sbjct: 19 GKKFDKVSRIEARSEQFDMYMQLDVNTEIYPLHVGDKFTMVLAP 62 Score = 25.8 bits (55), Expect(2) = 7e-06 Identities = 10/13 (76%), Positives = 11/13 (84%) Frame = +2 Query: 350 SLDGAPDSGYSLQ 388 SLDG PDSGY +Q Sbjct: 65 SLDGTPDSGYYMQ 77