BLASTX nr result
ID: Magnolia22_contig00030742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00030742 (446 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OAL04539.1 aquaporin-like protein [Stagonospora sp. SRC1lsM3a] 88 6e-18 XP_001791202.1 hypothetical protein SNOG_00518 [Parastagonospora... 70 3e-11 KZL84932.1 aquaporin rerated other eukaryote [Colletotrichum inc... 69 6e-11 XP_018151587.1 Aquaporin [Colletotrichum higginsianum IMI 349063... 62 2e-08 XP_003844260.1 hypothetical protein LEMA_P019110.1 [Leptosphaeri... 60 6e-08 KZL64599.1 MIP family channel protein [Colletotrichum tofieldiae] 57 7e-07 >OAL04539.1 aquaporin-like protein [Stagonospora sp. SRC1lsM3a] Length = 339 Score = 88.2 bits (217), Expect = 6e-18 Identities = 48/85 (56%), Positives = 57/85 (67%) Frame = -3 Query: 444 FYMFIKALEYETVNLEVADPKKALGEKFAHKEKLGSREHKEKLDAPEHREKLESRDGVDS 265 FYMFIKALEYETVNL+V DPKKALGEKF R HK +E L++ +G + Sbjct: 265 FYMFIKALEYETVNLKVDDPKKALGEKF-------DRTHK--------KESLDTHNGTHT 309 Query: 264 GYAHDRSMSGGSHATFDRASTMEKG 190 +HDR+MSGGS TFDRA T+E G Sbjct: 310 AISHDRTMSGGSGDTFDRAPTLEDG 334 >XP_001791202.1 hypothetical protein SNOG_00518 [Parastagonospora nodorum SN15] EAT92013.1 hypothetical protein SNOG_00518 [Parastagonospora nodorum SN15] Length = 336 Score = 69.7 bits (169), Expect = 3e-11 Identities = 45/89 (50%), Positives = 49/89 (55%) Frame = -3 Query: 444 FYMFIKALEYETVNLEVADPKKALGEKFAHKEKLGSREHKEKLDAPEHREKLESRDGVDS 265 FYMFIKALEYETVNLE DPK ALGEKF AP SRDG S Sbjct: 267 FYMFIKALEYETVNLEGDDPKAALGEKFK--------------GAP------ASRDGAVS 306 Query: 264 GYAHDRSMSGGSHATFDRASTMEKGDGSP 178 G H R+ SGGS T+D+A +E G P Sbjct: 307 G--HRRTASGGSSDTYDKAPVLENGSPPP 333 >KZL84932.1 aquaporin rerated other eukaryote [Colletotrichum incanum] OHW97043.1 MIP family channel protein [Colletotrichum incanum] Length = 339 Score = 68.9 bits (167), Expect = 6e-11 Identities = 38/90 (42%), Positives = 52/90 (57%) Frame = -3 Query: 444 FYMFIKALEYETVNLEVADPKKALGEKFAHKEKLGSREHKEKLDAPEHREKLESRDGVDS 265 FYMFIKALEYETVN V DPK+ALGEKF D +EK + +++ Sbjct: 265 FYMFIKALEYETVN-NVTDPKQALGEKF---------------DLRNRKEKPATHGSIET 308 Query: 264 GYAHDRSMSGGSHATFDRASTMEKGDGSPT 175 G+ D+++SGG T+D + +E G +PT Sbjct: 309 GHTIDKAVSGGMGDTYDHSPDLENGHTAPT 338 >XP_018151587.1 Aquaporin [Colletotrichum higginsianum IMI 349063] CCF41794.1 aquaporin [Colletotrichum higginsianum] OBR03069.1 Aquaporin [Colletotrichum higginsianum IMI 349063] Length = 339 Score = 62.0 bits (149), Expect = 2e-08 Identities = 39/85 (45%), Positives = 49/85 (57%) Frame = -3 Query: 444 FYMFIKALEYETVNLEVADPKKALGEKFAHKEKLGSREHKEKLDAPEHREKLESRDGVDS 265 FYMFIKALEYETVN VADPKKALGEKF H+ + KE+ E E D Sbjct: 265 FYMFIKALEYETVN-NVADPKKALGEKFNHQNR------KERSATHESTEPSHPVD---- 313 Query: 264 GYAHDRSMSGGSHATFDRASTMEKG 190 D++ S S T++R+ ++E G Sbjct: 314 ----DKAASSSSKDTYNRSPSLENG 334 >XP_003844260.1 hypothetical protein LEMA_P019110.1 [Leptosphaeria maculans JN3] CBY00781.1 hypothetical protein LEMA_P019110.1 [Leptosphaeria maculans JN3] Length = 336 Score = 60.5 bits (145), Expect = 6e-08 Identities = 38/85 (44%), Positives = 47/85 (55%) Frame = -3 Query: 444 FYMFIKALEYETVNLEVADPKKALGEKFAHKEKLGSREHKEKLDAPEHREKLESRDGVDS 265 FYMFIKALEYETVN+ VADPK+ALG+KF K E +D V S Sbjct: 265 FYMFIKALEYETVNM-VADPKQALGDKF-----------------DRTTVKSEGQDSVAS 306 Query: 264 GYAHDRSMSGGSHATFDRASTMEKG 190 G ++ MSG S +F R+ +E G Sbjct: 307 GKTVEKVMSGVSGGSFKRSPALESG 331 >KZL64599.1 MIP family channel protein [Colletotrichum tofieldiae] Length = 338 Score = 57.4 bits (137), Expect = 7e-07 Identities = 35/74 (47%), Positives = 43/74 (58%) Frame = -3 Query: 444 FYMFIKALEYETVNLEVADPKKALGEKFAHKEKLGSREHKEKLDAPEHREKLESRDGVDS 265 FYMFIKALEYETVN VADPK+ALGEKF + + ++ E +K SRD D+ Sbjct: 265 FYMFIKALEYETVN-NVADPKQALGEKFDLRNRKSKPATHRSVEPDETVDKTVSRDLGDT 323 Query: 264 GYAHDRSMSGGSHA 223 Y H + G A Sbjct: 324 -YDHSPDLENGHTA 336