BLASTX nr result
ID: Magnolia22_contig00030597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00030597 (342 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018000529.1 hypothetical protein AB675_7508 [Phialophora atta... 54 6e-06 >XP_018000529.1 hypothetical protein AB675_7508 [Phialophora attae] KPI40566.1 hypothetical protein AB675_7508 [Phialophora attae] Length = 870 Score = 53.5 bits (127), Expect = 6e-06 Identities = 25/58 (43%), Positives = 39/58 (67%) Frame = +2 Query: 2 EIVSAPGMGLILKDGVIALRLRDTDMVKREQLAAQERLGSLEDRPIAELLDLLDFGAR 175 EIV+APGMG++LKD V++LR++D + ++ +Q A LG E+R + LL L+ R Sbjct: 766 EIVAAPGMGVVLKDSVVSLRMQDEEKLEEQQKKAHRDLGGWEERSVKVLLQQLEAPGR 823