BLASTX nr result
ID: Magnolia22_contig00030588
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00030588 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013259472.1 hypothetical protein A1O9_07072 [Exophiala aquama... 54 1e-05 >XP_013259472.1 hypothetical protein A1O9_07072 [Exophiala aquamarina CBS 119918] KEF56882.1 hypothetical protein A1O9_07072 [Exophiala aquamarina CBS 119918] Length = 389 Score = 53.9 bits (128), Expect = 1e-05 Identities = 28/52 (53%), Positives = 39/52 (75%), Gaps = 5/52 (9%) Frame = +1 Query: 109 TSSLMDD----RGLDNKMSNLNMQDPMQPTPR-PIARTDTDTKEVELFVDAE 249 T++LMDD G++N++SNL++Q PM P R P+ R DTDT EV++FVDAE Sbjct: 337 TANLMDDDDHLSGVNNQVSNLSLQQPMVPQGRRPLQRMDTDTSEVDVFVDAE 388