BLASTX nr result
ID: Magnolia22_contig00030570
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00030570 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AHN49476.1 ribosomal protein S3, partial (chloroplast) [Pectis s... 49 5e-06 >AHN49476.1 ribosomal protein S3, partial (chloroplast) [Pectis stenophylla var. biaristata] Length = 35 Score = 49.3 bits (116), Expect = 5e-06 Identities = 21/33 (63%), Positives = 27/33 (81%) Frame = +3 Query: 9 GSPTNHLSKIDHCS*TIQTIYG*LGVKFWIFVE 107 GS TN +KID+CS T++TIYG LG+K WIF+E Sbjct: 1 GSTTNIRAKIDYCSYTVRTIYGVLGIKIWIFIE 33