BLASTX nr result
ID: Magnolia22_contig00028236
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00028236 (359 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003655819.1 autophagy protein atg15 [Thielavia terrestris NRR... 55 3e-06 XP_001208853.1 hypothetical protein ATEG_01488 [Aspergillus terr... 54 8e-06 >XP_003655819.1 autophagy protein atg15 [Thielavia terrestris NRRL 8126] AEO69483.1 autophagy protein atg15 [Thielavia terrestris NRRL 8126] Length = 634 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/67 (40%), Positives = 37/67 (55%) Frame = +3 Query: 69 PGWFGGGCESISSIPTSTHHAPTKTGKDNETCETPGFFFGCWDPEPSESHTKHTKTKHAS 248 PGWFG C+ ++ T+T P +T + TC TPG F+GC D +E+ T T T+ S Sbjct: 525 PGWFG--CKDKTTTTTTTSTTPVETSTTSTTCLTPGRFWGCNDKTTTETSTTTTTTQEQS 582 Query: 249 ITEPPMS 269 PP S Sbjct: 583 TITPPPS 589 >XP_001208853.1 hypothetical protein ATEG_01488 [Aspergillus terreus NIH2624] Q0CXU6.1 RecName: Full=Putative lipase atg15; AltName: Full=Autophagy-related protein 15 EAU38245.1 hypothetical protein ATEG_01488 [Aspergillus terreus NIH2624] Length = 613 Score = 53.5 bits (127), Expect = 8e-06 Identities = 31/67 (46%), Positives = 38/67 (56%), Gaps = 2/67 (2%) Frame = +3 Query: 69 PGWFGGGCESISSIPTSTHHAPTKTGKDNET--CETPGFFFGCWDPEPSESHTKHTKTKH 242 PGWFG C +S PTST PT+T +T CE+PGFF+GCWDP+ + H Sbjct: 562 PGWFG--CRDPTS-PTST---PTQTPPPGDTTSCESPGFFWGCWDPKTTSDH-------- 607 Query: 243 ASITEPP 263 IT PP Sbjct: 608 -PITTPP 613