BLASTX nr result
ID: Magnolia22_contig00028114
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00028114 (347 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OLN88230.1 Organic hydroperoxide resistance protein [Colletotric... 62 4e-09 XP_014558007.1 hypothetical protein COCVIDRAFT_36641 [Bipolaris ... 60 1e-08 XP_007684997.1 hypothetical protein COCMIDRAFT_87071 [Bipolaris ... 60 1e-08 XP_007715833.1 hypothetical protein COCCADRAFT_39827 [Bipolaris ... 60 1e-08 XP_014079452.1 hypothetical protein COCC4DRAFT_23296 [Bipolaris ... 60 1e-08 XP_007700177.1 hypothetical protein COCSADRAFT_190466 [Bipolaris... 60 1e-08 KDN63869.1 putative organic hydroperoxide resistance protein [Co... 59 4e-08 OHE94590.1 organic hydroperoxide resistance protein [Colletotric... 59 4e-08 KZL77154.1 organic hydroperoxide resistance protein [Colletotric... 58 8e-08 XP_018162038.1 Organic hydroperoxide resistance protein [Colleto... 57 2e-07 KIL86439.1 hypothetical protein FAVG1_10268 [Fusarium avenaceum] 56 2e-07 XP_008089078.1 OsmC-like protein [Colletotrichum graminicola M1.... 56 3e-07 EQB49559.1 hypothetical protein CGLO_11109 [Colletotrichum gloeo... 57 3e-07 XP_007286679.1 organic hydroperoxide resistance protein [Colleto... 57 3e-07 XP_013314857.1 hypothetical protein PV05_06640 [Exophiala xenobi... 55 3e-07 KNG50970.1 organic hydroperoxide resistance protein [Stemphylium... 55 3e-07 KZL67458.1 organic hydroperoxide resistance protein [Colletotric... 57 3e-07 KOS44790.1 hypothetical protein ACN38_g4262 [Penicillium nordicum] 56 3e-07 OAL44706.1 OsmC-like protein [Pyrenochaeta sp. DS3sAY3a] 56 3e-07 XP_008716046.1 hypothetical protein HMPREF1541_03473 [Cyphelloph... 54 1e-06 >OLN88230.1 Organic hydroperoxide resistance protein [Colletotrichum chlorophyti] Length = 231 Score = 61.6 bits (148), Expect = 4e-09 Identities = 32/52 (61%), Positives = 37/52 (71%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD*VVPESAGEGDLR 191 +GLSNE+++KV DKAKEVCPYSRAT GNV T I V + D ES G LR Sbjct: 155 KGLSNEEVQKVVDKAKEVCPYSRATKGNVTTNIEVVKFD----ESGSSGGLR 202 >XP_014558007.1 hypothetical protein COCVIDRAFT_36641 [Bipolaris victoriae FI3] EUN28423.1 hypothetical protein COCVIDRAFT_36641 [Bipolaris victoriae FI3] Length = 178 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQM 233 RGLS ++L+KV +KA+EVCPYSRAT GNVHTTI E M Sbjct: 141 RGLSEQELEKVVNKAREVCPYSRATQGNVHTTIKCETM 178 >XP_007684997.1 hypothetical protein COCMIDRAFT_87071 [Bipolaris oryzae ATCC 44560] EUC48583.1 hypothetical protein COCMIDRAFT_87071 [Bipolaris oryzae ATCC 44560] Length = 178 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQM 233 RGLS ++L+KV +KA+EVCPYSRAT GNVHTTI E M Sbjct: 141 RGLSEQELEKVVNKAREVCPYSRATQGNVHTTIKCETM 178 >XP_007715833.1 hypothetical protein COCCADRAFT_39827 [Bipolaris zeicola 26-R-13] EUC29854.1 hypothetical protein COCCADRAFT_39827 [Bipolaris zeicola 26-R-13] Length = 178 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQM 233 RGLS ++L+KV +KA+EVCPYSRAT GNVHTTI E M Sbjct: 141 RGLSEQELEKVVNKAREVCPYSRATQGNVHTTIKCETM 178 >XP_014079452.1 hypothetical protein COCC4DRAFT_23296 [Bipolaris maydis ATCC 48331] EMD88742.1 hypothetical protein COCHEDRAFT_1109179 [Bipolaris maydis C5] ENI05543.1 hypothetical protein COCC4DRAFT_23296 [Bipolaris maydis ATCC 48331] Length = 178 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQM 233 RGLS ++L+KV +KA+EVCPYSRAT GNVHTTI E M Sbjct: 141 RGLSEQELEKVVNKAREVCPYSRATQGNVHTTIKCETM 178 >XP_007700177.1 hypothetical protein COCSADRAFT_190466 [Bipolaris sorokiniana ND90Pr] EMD64366.1 hypothetical protein COCSADRAFT_190466 [Bipolaris sorokiniana ND90Pr] Length = 178 Score = 59.7 bits (143), Expect = 1e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQM 233 RGLS ++L+KV +KA+EVCPYSRAT GNVHTTI E M Sbjct: 141 RGLSEQELEKVVNKAREVCPYSRATQGNVHTTIKCETM 178 >KDN63869.1 putative organic hydroperoxide resistance protein [Colletotrichum sublineola] Length = 246 Score = 59.3 bits (142), Expect = 4e-08 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 +GLSNE+++KV DKAKEVCPYSRAT GNV T I V + D Sbjct: 153 KGLSNEEVQKVVDKAKEVCPYSRATKGNVETNIKVVKFD 191 >OHE94590.1 organic hydroperoxide resistance protein [Colletotrichum orchidophilum] Length = 224 Score = 58.9 bits (141), Expect = 4e-08 Identities = 27/39 (69%), Positives = 34/39 (87%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 +GLS+E+++KV DKAKEVCPYSRATAGNV TTI V + + Sbjct: 152 KGLSDEEVQKVVDKAKEVCPYSRATAGNVATTIEVVKFE 190 >KZL77154.1 organic hydroperoxide resistance protein [Colletotrichum tofieldiae] Length = 234 Score = 58.2 bits (139), Expect = 8e-08 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 +GLSNE+++KV DKAKEVCPYSRAT GNV T + V + D Sbjct: 153 KGLSNEEVQKVVDKAKEVCPYSRATKGNVTTNVEVVKFD 191 >XP_018162038.1 Organic hydroperoxide resistance protein [Colletotrichum higginsianum IMI 349063] CCF36680.1 organic hydroperoxide resistance protein [Colletotrichum higginsianum] OBR13521.1 Organic hydroperoxide resistance protein [Colletotrichum higginsianum IMI 349063] Length = 227 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 +GLSN++++KV DKAKEVCPYSRAT GNV T I V + D Sbjct: 146 KGLSNDEVQKVVDKAKEVCPYSRATKGNVTTNIEVVKFD 184 >KIL86439.1 hypothetical protein FAVG1_10268 [Fusarium avenaceum] Length = 179 Score = 56.2 bits (134), Expect = 2e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 +GL +DL+KV +KAKE+CPYS+AT GNV T + V QMD Sbjct: 141 KGLKKDDLEKVVEKAKEICPYSKATKGNVATNVEVVQMD 179 >XP_008089078.1 OsmC-like protein [Colletotrichum graminicola M1.001] EFQ25058.1 OsmC-like protein [Colletotrichum graminicola M1.001] Length = 167 Score = 55.8 bits (133), Expect = 3e-07 Identities = 25/39 (64%), Positives = 31/39 (79%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 +GLSNE+++KV DKAK+VCPYSRA GNV T I V + D Sbjct: 78 KGLSNEEVQKVVDKAKDVCPYSRAIKGNVETNIKVVKFD 116 >EQB49559.1 hypothetical protein CGLO_11109 [Colletotrichum gloeosporioides Cg-14] Length = 225 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITV 242 +GLS+E+++KV DKAKEVCPYSRAT GNV TTI V Sbjct: 151 KGLSDEEVQKVVDKAKEVCPYSRATKGNVTTTIEV 185 >XP_007286679.1 organic hydroperoxide resistance protein [Colletotrichum gloeosporioides Nara gc5] ELA24244.1 organic hydroperoxide resistance protein [Colletotrichum gloeosporioides Nara gc5] Length = 225 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITV 242 +GLS+E+++KV DKAKEVCPYSRAT GNV TTI V Sbjct: 151 KGLSDEEVQKVVDKAKEVCPYSRATKGNVTTTIEV 185 >XP_013314857.1 hypothetical protein PV05_06640 [Exophiala xenobiotica] KIW54273.1 hypothetical protein PV05_06640 [Exophiala xenobiotica] Length = 115 Score = 54.7 bits (130), Expect = 3e-07 Identities = 26/38 (68%), Positives = 30/38 (78%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQM 233 +GLS E L+KV +KAKEVCPYSRAT GNV T I V Q+ Sbjct: 78 KGLSKESLEKVVNKAKEVCPYSRATKGNVTTNIEVVQL 115 >KNG50970.1 organic hydroperoxide resistance protein [Stemphylium lycopersici] Length = 116 Score = 54.7 bits (130), Expect = 3e-07 Identities = 24/39 (61%), Positives = 31/39 (79%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 RGL+ EDL+KV KA++VCPYSRAT NV+TT+ E M+ Sbjct: 78 RGLAKEDLEKVVHKARQVCPYSRATKDNVYTTVRCETME 116 >KZL67458.1 organic hydroperoxide resistance protein [Colletotrichum incanum] OHW91248.1 putative organic hydroperoxide resistance protein [Colletotrichum incanum] Length = 237 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQMD 230 +GLSNE+++KV +KAKEVCPYSRAT GNV T I V + D Sbjct: 153 KGLSNEEVQKVVNKAKEVCPYSRATKGNVTTNIEVVKFD 191 >KOS44790.1 hypothetical protein ACN38_g4262 [Penicillium nordicum] Length = 178 Score = 55.8 bits (133), Expect = 3e-07 Identities = 23/35 (65%), Positives = 30/35 (85%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITV 242 RGL+ + ++KV +KAKEVCPYSRAT GNVHTT+ + Sbjct: 141 RGLAKDQVEKVVEKAKEVCPYSRATQGNVHTTVEI 175 >OAL44706.1 OsmC-like protein [Pyrenochaeta sp. DS3sAY3a] Length = 182 Score = 55.8 bits (133), Expect = 3e-07 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVEQM 233 RGL+ +DL+KV +A+EVCPYSRAT GNV+TT+ E M Sbjct: 145 RGLAEQDLEKVVQRAREVCPYSRATKGNVYTTVRCETM 182 >XP_008716046.1 hypothetical protein HMPREF1541_03473 [Cyphellophora europaea CBS 101466] ETN41537.1 hypothetical protein HMPREF1541_03473 [Cyphellophora europaea CBS 101466] Length = 176 Score = 54.3 bits (129), Expect = 1e-06 Identities = 26/36 (72%), Positives = 27/36 (75%) Frame = -2 Query: 346 RGLSNEDLKKVTDKAKEVCPYSRATAGNVHTTITVE 239 +GLS ED KV KAKEVCPYSRAT GNV T IT E Sbjct: 139 KGLSQEDFDKVIKKAKEVCPYSRATQGNVTTNITTE 174