BLASTX nr result
ID: Magnolia22_contig00028005
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00028005 (504 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_069658252.1 RNA-binding protein [Arcticibacter eurypsychrophi... 52 7e-06 WP_016193459.1 RNA-binding protein [Arcticibacter svalbardensis]... 52 7e-06 >WP_069658252.1 RNA-binding protein [Arcticibacter eurypsychrophilus] Length = 109 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/68 (36%), Positives = 39/68 (57%) Frame = +2 Query: 173 ELNFKRVFGREALVREVVILKSKEFGRARGSAFVRLEKSEEVATAVKALSGGSFKGMKIV 352 E + VFG +V+ + I+K +E G++RG FV + EE A+K ++GG + G KI Sbjct: 14 EAELRAVFGDFGVVKSLRIIKDRETGKSRGFGFVEMPNDEEAKEAIKNMNGGDYNGSKIT 73 Query: 353 VQRAHFGP 376 V+ A P Sbjct: 74 VKVAEDKP 81 >WP_016193459.1 RNA-binding protein [Arcticibacter svalbardensis] EOR96574.1 RNA-binding protein [Arcticibacter svalbardensis MN12-7] Length = 110 Score = 52.4 bits (124), Expect = 7e-06 Identities = 25/68 (36%), Positives = 39/68 (57%) Frame = +2 Query: 173 ELNFKRVFGREALVREVVILKSKEFGRARGSAFVRLEKSEEVATAVKALSGGSFKGMKIV 352 E + VFG +V+ + I+K +E G++RG FV + EE A+K ++GG + G KI Sbjct: 14 EAELRAVFGDFGVVKSLRIIKDRETGKSRGFGFVEMPNDEEAKEAIKNMNGGDYNGSKIT 73 Query: 353 VQRAHFGP 376 V+ A P Sbjct: 74 VKVAEDKP 81