BLASTX nr result
ID: Magnolia22_contig00027751
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00027751 (409 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013258908.1 hypothetical protein A1O9_07899 [Exophiala aquama... 71 3e-12 XP_007725343.1 hypothetical protein A1O1_06274 [Capronia coronat... 69 2e-11 XP_008728901.1 hypothetical protein G647_06357 [Cladophialophora... 67 1e-10 XP_013313325.1 hypothetical protein PV05_08364 [Exophiala xenobi... 66 2e-10 XP_009155992.1 hypothetical protein HMPREF1120_03664 [Exophiala ... 66 3e-10 OAG39932.1 hypothetical protein AYO21_05805 [Fonsecaea monophora] 66 3e-10 XP_013289429.1 hypothetical protein Z517_01013 [Fonsecaea pedros... 66 3e-10 OCT51743.1 hypothetical protein CLCR_08920 [Cladophialophora car... 65 5e-10 XP_016266649.1 hypothetical protein PV06_02105 [Exophiala oligos... 65 5e-10 XP_007734195.1 hypothetical protein A1O3_05885 [Capronia epimyce... 65 6e-10 XP_018694016.1 hypothetical protein AYL99_05651 [Fonsecaea erect... 64 1e-09 XP_016230094.1 hypothetical protein PV08_11979 [Exophiala spinif... 64 1e-09 XP_016622011.1 hypothetical protein Z519_03926 [Cladophialophora... 64 1e-09 XP_007747504.1 hypothetical protein A1O5_08733 [Cladophialophora... 64 2e-09 XP_016252317.1 hypothetical protein PV07_03671 [Cladophialophora... 63 3e-09 KIV79468.1 hypothetical protein PV11_07030 [Exophiala sideris] 63 3e-09 XP_013271745.1 hypothetical protein Z518_05479 [Rhinocladiella m... 62 5e-09 OAL25599.1 hypothetical protein AYO20_10440 [Fonsecaea nubica] 63 5e-09 KIW67310.1 hypothetical protein PV04_06574 [Capronia semi-immersa] 62 7e-09 XP_016629772.1 hypothetical protein Z520_08769 [Fonsecaea multim... 60 3e-08 >XP_013258908.1 hypothetical protein A1O9_07899 [Exophiala aquamarina CBS 119918] KEF56318.1 hypothetical protein A1O9_07899 [Exophiala aquamarina CBS 119918] Length = 238 Score = 70.9 bits (172), Expect = 3e-12 Identities = 37/60 (61%), Positives = 41/60 (68%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMVR 181 SRFGDSS G + ++ KHHFHI+PGRKRGQSG GSELG M RP S GK E VR Sbjct: 185 SRFGDSS--GETTTKEDGKHHFHILPGRKRGQSGTGSELGDM----PRPQSNGKAEVSVR 238 >XP_007725343.1 hypothetical protein A1O1_06274 [Capronia coronata CBS 617.96] EXJ85905.1 hypothetical protein A1O1_06274 [Capronia coronata CBS 617.96] Length = 238 Score = 68.9 bits (167), Expect = 2e-11 Identities = 36/60 (60%), Positives = 41/60 (68%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMVR 181 SRFGDSS+ A D KHHFH++PGR+RGQSG GSELG + SRP S GK E VR Sbjct: 184 SRFGDSSSDAAPVKED-GKHHFHLLPGRRRGQSGTGSELGEI----SRPESSGKAEVTVR 238 >XP_008728901.1 hypothetical protein G647_06357 [Cladophialophora carrionii CBS 160.54] ETI22284.1 hypothetical protein G647_06357 [Cladophialophora carrionii CBS 160.54] Length = 248 Score = 66.6 bits (161), Expect = 1e-10 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 2/62 (3%) Frame = +2 Query: 2 SRFGDSSTHGAEKSS--DESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETM 175 SRFGDS+ A ++ +E KHHFH +PGR+RGQSG G+ELG + RP SRG PE Sbjct: 191 SRFGDSNGEPAAPAAGKEEGKHHFHFLPGRRRGQSGTGNELGDI----PRPQSRGHPEVT 246 Query: 176 VR 181 VR Sbjct: 247 VR 248 >XP_013313325.1 hypothetical protein PV05_08364 [Exophiala xenobiotica] KIW52741.1 hypothetical protein PV05_08364 [Exophiala xenobiotica] Length = 239 Score = 65.9 bits (159), Expect = 2e-10 Identities = 36/60 (60%), Positives = 39/60 (65%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMVR 181 SRFGDSS + +E KHHFHIIPGRKRGQSG GSEL + RP S GK E VR Sbjct: 185 SRFGDSSGENLT-TKEEGKHHFHIIPGRKRGQSGTGSELKDI----PRPQSNGKAEVTVR 239 >XP_009155992.1 hypothetical protein HMPREF1120_03664 [Exophiala dermatitidis NIH/UT8656] EHY55531.1 hypothetical protein HMPREF1120_03664 [Exophiala dermatitidis NIH/UT8656] Length = 244 Score = 65.9 bits (159), Expect = 3e-10 Identities = 35/62 (56%), Positives = 44/62 (70%), Gaps = 2/62 (3%) Frame = +2 Query: 2 SRFGDSSTHGAEKS-SDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRG-KPETM 175 +RFGDS+++G S D+ KHHFH++PGRKRGQSG G+ELG M RP S G K E + Sbjct: 187 ARFGDSNSNGDSGSVKDDGKHHFHLLPGRKRGQSGTGNELGDM----PRPQSSGSKAEVV 242 Query: 176 VR 181 VR Sbjct: 243 VR 244 >OAG39932.1 hypothetical protein AYO21_05805 [Fonsecaea monophora] Length = 246 Score = 65.9 bits (159), Expect = 3e-10 Identities = 36/65 (55%), Positives = 42/65 (64%), Gaps = 5/65 (7%) Frame = +2 Query: 2 SRFGDSS-----THGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKP 166 SRFGDS+ T+G K +E KHHFH +PGRKRGQSG G+ELG + RP SRG Sbjct: 188 SRFGDSNGETITTNGTNK--EEGKHHFHFLPGRKRGQSGTGNELGDI----QRPQSRGNA 241 Query: 167 ETMVR 181 E VR Sbjct: 242 EVTVR 246 >XP_013289429.1 hypothetical protein Z517_01013 [Fonsecaea pedrosoi CBS 271.37] KIW85621.1 hypothetical protein Z517_01013 [Fonsecaea pedrosoi CBS 271.37] Length = 246 Score = 65.9 bits (159), Expect = 3e-10 Identities = 36/65 (55%), Positives = 42/65 (64%), Gaps = 5/65 (7%) Frame = +2 Query: 2 SRFGDSS-----THGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKP 166 SRFGDS+ T+G K +E KHHFH +PGRKRGQSG G+ELG + RP SRG Sbjct: 188 SRFGDSNGETITTNGTNK--EEGKHHFHFLPGRKRGQSGTGNELGDI----QRPQSRGNA 241 Query: 167 ETMVR 181 E VR Sbjct: 242 EVTVR 246 >OCT51743.1 hypothetical protein CLCR_08920 [Cladophialophora carrionii] Length = 238 Score = 65.1 bits (157), Expect = 5e-10 Identities = 33/62 (53%), Positives = 41/62 (66%), Gaps = 2/62 (3%) Frame = +2 Query: 2 SRFGDSSTHGAEKSS--DESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETM 175 SRFGDS+ ++ +E KHHFH +PGR+RGQSG G+ELG + RP SRG PE Sbjct: 181 SRFGDSNGEPVAPAAGKEEGKHHFHFLPGRRRGQSGTGNELGDI----PRPQSRGHPEVT 236 Query: 176 VR 181 VR Sbjct: 237 VR 238 >XP_016266649.1 hypothetical protein PV06_02105 [Exophiala oligosperma] KIW46433.1 hypothetical protein PV06_02105 [Exophiala oligosperma] Length = 241 Score = 65.1 bits (157), Expect = 5e-10 Identities = 35/60 (58%), Positives = 39/60 (65%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMVR 181 SRFGDS+ S ++ KHHFHIIPGRKRGQSG GSEL + RP S GK E VR Sbjct: 187 SRFGDSNGENVP-SKEDGKHHFHIIPGRKRGQSGTGSELKDI----PRPQSNGKAEVTVR 241 >XP_007734195.1 hypothetical protein A1O3_05885 [Capronia epimyces CBS 606.96] EXJ85210.1 hypothetical protein A1O3_05885 [Capronia epimyces CBS 606.96] Length = 237 Score = 64.7 bits (156), Expect = 6e-10 Identities = 34/60 (56%), Positives = 38/60 (63%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMVR 181 SRFGDSS D KHHFH++PGR+RGQSG G ELG M RP S GK E +VR Sbjct: 183 SRFGDSSGDTGSVKED-GKHHFHLLPGRRRGQSGTGDELGDM----PRPQSSGKAEVVVR 237 >XP_018694016.1 hypothetical protein AYL99_05651 [Fonsecaea erecta] OAP60649.1 hypothetical protein AYL99_05651 [Fonsecaea erecta] Length = 246 Score = 64.3 bits (155), Expect = 1e-09 Identities = 36/65 (55%), Positives = 42/65 (64%), Gaps = 5/65 (7%) Frame = +2 Query: 2 SRFGDSS-----THGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKP 166 SRFGDS+ T+ A K +E KHHFH +PGRKRGQSG G+ELG + RP SRG Sbjct: 188 SRFGDSNGETVTTNAATK--EEGKHHFHFLPGRKRGQSGTGNELGDI----PRPQSRGNA 241 Query: 167 ETMVR 181 E VR Sbjct: 242 EVTVR 246 >XP_016230094.1 hypothetical protein PV08_11979 [Exophiala spinifera] KIW09878.1 hypothetical protein PV08_11979 [Exophiala spinifera] Length = 241 Score = 63.9 bits (154), Expect = 1e-09 Identities = 34/60 (56%), Positives = 39/60 (65%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMVR 181 SRFGDS+ S ++ KHHFHIIPGR+RGQSG GSEL + RP S GK E VR Sbjct: 187 SRFGDSNGENVP-SKEDGKHHFHIIPGRRRGQSGTGSELKDI----PRPQSNGKAEVTVR 241 >XP_016622011.1 hypothetical protein Z519_03926 [Cladophialophora bantiana CBS 173.52] KIW95342.1 hypothetical protein Z519_03926 [Cladophialophora bantiana CBS 173.52] Length = 247 Score = 63.9 bits (154), Expect = 1e-09 Identities = 36/65 (55%), Positives = 42/65 (64%), Gaps = 5/65 (7%) Frame = +2 Query: 2 SRFGDSS-----THGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKP 166 SRFGDS+ T A K +E KHHFH +PGRKRGQSG G+ELG + RP SRG Sbjct: 189 SRFGDSNGETITTTAATK--EEGKHHFHFLPGRKRGQSGTGNELGDI----PRPQSRGNA 242 Query: 167 ETMVR 181 E +VR Sbjct: 243 EVIVR 247 >XP_007747504.1 hypothetical protein A1O5_08733 [Cladophialophora psammophila CBS 110553] EXJ68118.1 hypothetical protein A1O5_08733 [Cladophialophora psammophila CBS 110553] Length = 247 Score = 63.5 bits (153), Expect = 2e-09 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 3/63 (4%) Frame = +2 Query: 2 SRFGDSSTHGAEKSS---DESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPET 172 SRFGDS+ ++ +E KHHFH +PGRKRGQSG G+ELG + RP SRG E Sbjct: 189 SRFGDSNGETITTTAPTKEEGKHHFHFLPGRKRGQSGTGNELGDI----PRPQSRGNAEV 244 Query: 173 MVR 181 +VR Sbjct: 245 IVR 247 >XP_016252317.1 hypothetical protein PV07_03671 [Cladophialophora immunda] KIW32101.1 hypothetical protein PV07_03671 [Cladophialophora immunda] Length = 246 Score = 63.2 bits (152), Expect = 3e-09 Identities = 33/63 (52%), Positives = 40/63 (63%), Gaps = 3/63 (4%) Frame = +2 Query: 2 SRFGDSSTHGAEKSS---DESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPET 172 SRFGDS+ ++ +E KHHFH +PGRKRGQSG G+ELG + RP SRG E Sbjct: 188 SRFGDSNGETITSNAANKEEGKHHFHFLPGRKRGQSGTGNELGDI----PRPQSRGNAEV 243 Query: 173 MVR 181 VR Sbjct: 244 TVR 246 >KIV79468.1 hypothetical protein PV11_07030 [Exophiala sideris] Length = 237 Score = 62.8 bits (151), Expect = 3e-09 Identities = 36/60 (60%), Positives = 40/60 (66%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMVR 181 SRFGDSS A ++ KHHFHI PGRKRGQSG GSEL + RP S+GKPE VR Sbjct: 184 SRFGDSSGE-APAVKEDGKHHFHI-PGRKRGQSGTGSELKDI----PRPQSKGKPEVTVR 237 >XP_013271745.1 hypothetical protein Z518_05479 [Rhinocladiella mackenziei CBS 650.93] KIX04609.1 hypothetical protein Z518_05479 [Rhinocladiella mackenziei CBS 650.93] Length = 238 Score = 62.4 bits (150), Expect = 5e-09 Identities = 30/59 (50%), Positives = 37/59 (62%) Frame = +2 Query: 2 SRFGDSSTHGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETMV 178 SRFGDS+ + ++ KHHFH++PGRKRGQSG G ELG + RP S G E V Sbjct: 183 SRFGDSNGEIPTPAKEDGKHHFHLLPGRKRGQSGTGRELGDL----PRPRSNGSAEVTV 237 >OAL25599.1 hypothetical protein AYO20_10440 [Fonsecaea nubica] Length = 306 Score = 62.8 bits (151), Expect = 5e-09 Identities = 34/61 (55%), Positives = 40/61 (65%), Gaps = 5/61 (8%) Frame = +2 Query: 2 SRFGDSS-----THGAEKSSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKP 166 SRFGDS+ T+G K +E KHHFH +PGRKRGQSG G+ELG + RP SRG Sbjct: 188 SRFGDSNGETITTNGTNK--EEGKHHFHFLPGRKRGQSGTGNELGDI----QRPQSRGNA 241 Query: 167 E 169 E Sbjct: 242 E 242 >KIW67310.1 hypothetical protein PV04_06574 [Capronia semi-immersa] Length = 248 Score = 62.0 bits (149), Expect = 7e-09 Identities = 31/62 (50%), Positives = 40/62 (64%), Gaps = 2/62 (3%) Frame = +2 Query: 2 SRFGDSSTHGAEKS--SDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPETM 175 SRFGDS+ + ++ KHHFH +PGR+RGQSG G+ELG + RP SRG+ E Sbjct: 191 SRFGDSNAEPVAPTPGKEDGKHHFHFLPGRRRGQSGTGNELGDI----PRPQSRGQAEVT 246 Query: 176 VR 181 VR Sbjct: 247 VR 248 >XP_016629772.1 hypothetical protein Z520_08769 [Fonsecaea multimorphosa CBS 102226] KIX95649.1 hypothetical protein Z520_08769 [Fonsecaea multimorphosa CBS 102226] OAL21250.1 hypothetical protein AYO22_08213 [Fonsecaea multimorphosa] Length = 249 Score = 60.5 bits (145), Expect = 3e-08 Identities = 32/62 (51%), Positives = 37/62 (59%), Gaps = 3/62 (4%) Frame = +2 Query: 2 SRFGDSSTHGAEK---SSDESKHHFHIIPGRKRGQSGNGSELGSMLNSSSRPASRGKPET 172 SRFGDS+ S +E KHHFH +PGRKRGQSG G+ELG + RP SRG Sbjct: 189 SRFGDSNGENVTANAASKEEGKHHFHFLPGRKRGQSGTGNELGDI----PRPQSRGNANA 244 Query: 173 MV 178 V Sbjct: 245 EV 246