BLASTX nr result
ID: Magnolia22_contig00026107
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00026107 (445 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAV70491.1 hypothetical protein CFOL_v3_13989, partial [Cephalot... 40 3e-06 >GAV70491.1 hypothetical protein CFOL_v3_13989, partial [Cephalotus follicularis] Length = 137 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 20/47 (42%), Positives = 31/47 (65%), Gaps = 4/47 (8%) Frame = +1 Query: 85 YDYYSQNMKN----NSRTSYFEMEGTNVEQITDLFMAKMDRKKEAKK 213 Y Y+S N NSR S F+++G +VEQ+++ FM KMDR++ +K Sbjct: 87 YKYFSPNESLYSDVNSRESSFQVKGIDVEQLSEGFMEKMDRQQSKRK 133 Score = 38.9 bits (89), Expect(2) = 3e-06 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = +2 Query: 2 LRKINDNAYVVDLLEDMNISHTFNIAD 82 L+KINDNAY +DL DM IS T N+A+ Sbjct: 59 LKKINDNAYAIDLPRDMGISKTSNVAN 85