BLASTX nr result
ID: Magnolia22_contig00026021
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00026021 (626 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZV53848.1 BTB/POZ domain-containing protein [Dorcoceras hygrome... 64 1e-08 KZV17740.1 glucan endo-1,3-beta-D-glucosidase, partial [Dorcocer... 64 2e-08 OMO57180.1 hypothetical protein CCACVL1_25941 [Corchorus capsula... 61 2e-07 OAY33292.1 hypothetical protein MANES_13G083500 [Manihot esculenta] 59 7e-07 XP_006652006.1 PREDICTED: BTB/POZ domain-containing protein At2g... 59 9e-07 XP_004981110.1 PREDICTED: BTB/POZ domain-containing protein At2g... 59 1e-06 XP_015637154.1 PREDICTED: BTB/POZ domain-containing protein At2g... 59 1e-06 XP_010236706.1 PREDICTED: BTB/POZ domain-containing protein At2g... 59 1e-06 XP_020165885.1 BTB/POZ domain-containing protein At2g13690 [Aegi... 59 1e-06 EEC76923.1 hypothetical protein OsI_15177 [Oryza sativa Indica G... 59 1e-06 CAE05100.3 OSJNBa0009K15.20 [Oryza sativa Japonica Group] 59 1e-06 XP_002463555.1 hypothetical protein SORBIDRAFT_01g001870 [Sorghu... 59 1e-06 EEE60654.1 hypothetical protein OsJ_14104 [Oryza sativa Japonica... 59 1e-06 XP_018844726.1 PREDICTED: BTB/POZ domain-containing protein At2g... 58 2e-06 XP_009408313.1 PREDICTED: BTB/POZ domain-containing protein At2g... 58 2e-06 GAV60380.1 hypothetical protein CFOL_v3_03911 [Cephalotus follic... 58 2e-06 OAY36085.1 hypothetical protein MANES_12G154700 [Manihot esculenta] 58 2e-06 KDO58322.1 hypothetical protein CISIN_1g041685mg, partial [Citru... 58 2e-06 XP_017969614.1 PREDICTED: BTB/POZ domain-containing protein At2g... 58 2e-06 XP_010467198.1 PREDICTED: BTB/POZ domain-containing protein At2g... 58 2e-06 >KZV53848.1 BTB/POZ domain-containing protein [Dorcoceras hygrometricum] Length = 473 Score = 64.3 bits (155), Expect = 1e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS CG ECPNLS+AFQIWWRRS TR Sbjct: 434 EWFSCFSKCGVECPNLSKAFQIWWRRSSTR 463 >KZV17740.1 glucan endo-1,3-beta-D-glucosidase, partial [Dorcoceras hygrometricum] Length = 737 Score = 64.3 bits (155), Expect = 2e-08 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS CG ECPNLS+AFQIWWRRS TR Sbjct: 263 EWFSCFSKCGVECPNLSKAFQIWWRRSSTR 292 >OMO57180.1 hypothetical protein CCACVL1_25941 [Corchorus capsularis] Length = 573 Score = 61.2 bits (147), Expect = 2e-07 Identities = 25/30 (83%), Positives = 26/30 (86%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWFGCFS GTECPNLS+AFQIWWRRS R Sbjct: 534 EWFGCFSKHGTECPNLSKAFQIWWRRSFLR 563 >OAY33292.1 hypothetical protein MANES_13G083500 [Manihot esculenta] Length = 550 Score = 59.3 bits (142), Expect = 7e-07 Identities = 25/30 (83%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLSRAFQIWWRRS R Sbjct: 511 EWFRCFSKHGTECPNLSRAFQIWWRRSFLR 540 >XP_006652006.1 PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Oryza brachyantha] Length = 490 Score = 58.9 bits (141), Expect = 9e-07 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ GTECPNLSRAFQ+WWRRS R Sbjct: 454 EWFQCFASRGTECPNLSRAFQVWWRRSFVR 483 >XP_004981110.1 PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Setaria italica] KQK86254.1 hypothetical protein SETIT_035173mg [Setaria italica] Length = 523 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ GTECPNLSRAFQ+WWRRS R Sbjct: 487 EWFRCFASRGTECPNLSRAFQVWWRRSFVR 516 >XP_015637154.1 PREDICTED: BTB/POZ domain-containing protein At2g13690 [Oryza sativa Japonica Group] BAF14270.1 Os04g0278000 [Oryza sativa Japonica Group] BAH00259.1 unnamed protein product [Oryza sativa Japonica Group] BAS88357.1 Os04g0278000 [Oryza sativa Japonica Group] Length = 527 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ GTECPNLSRAFQ+WWRRS R Sbjct: 491 EWFQCFASRGTECPNLSRAFQVWWRRSFVR 520 >XP_010236706.1 PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Brachypodium distachyon] KQK12220.1 hypothetical protein BRADI_1g02260 [Brachypodium distachyon] Length = 529 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLSRAF++WWRRS R Sbjct: 493 EWFQCFSSRGTECPNLSRAFEVWWRRSFVR 522 >XP_020165885.1 BTB/POZ domain-containing protein At2g13690 [Aegilops tauschii subsp. tauschii] Length = 532 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ G ECPNLSRAFQ+WWRRS TR Sbjct: 503 EWFQCFASRGAECPNLSRAFQVWWRRSFTR 532 >EEC76923.1 hypothetical protein OsI_15177 [Oryza sativa Indica Group] Length = 543 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ GTECPNLSRAFQ+WWRRS R Sbjct: 507 EWFQCFASRGTECPNLSRAFQVWWRRSFVR 536 >CAE05100.3 OSJNBa0009K15.20 [Oryza sativa Japonica Group] Length = 561 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ GTECPNLSRAFQ+WWRRS R Sbjct: 525 EWFQCFASRGTECPNLSRAFQVWWRRSFVR 554 >XP_002463555.1 hypothetical protein SORBIDRAFT_01g001870 [Sorghum bicolor] EER90553.1 hypothetical protein SORBI_001G019200 [Sorghum bicolor] Length = 563 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ GTECPNLSRAFQ+WWRRS R Sbjct: 527 EWFQCFASRGTECPNLSRAFQVWWRRSFVR 556 >EEE60654.1 hypothetical protein OsJ_14104 [Oryza sativa Japonica Group] Length = 579 Score = 58.9 bits (141), Expect = 1e-06 Identities = 23/30 (76%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+ GTECPNLSRAFQ+WWRRS R Sbjct: 543 EWFQCFASRGTECPNLSRAFQVWWRRSFVR 572 >XP_018844726.1 PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Juglans regia] Length = 537 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLS+AFQIWWRRS R Sbjct: 498 EWFQCFSKQGTECPNLSKAFQIWWRRSFLR 527 >XP_009408313.1 PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Musa acuminata subsp. malaccensis] Length = 543 Score = 58.2 bits (139), Expect = 2e-06 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CF+G GTECPNL +AFQ+WWRRS R Sbjct: 508 EWFRCFAGHGTECPNLCKAFQVWWRRSFVR 537 >GAV60380.1 hypothetical protein CFOL_v3_03911 [Cephalotus follicularis] Length = 545 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLS+AFQIWWRRS R Sbjct: 506 EWFRCFSTHGTECPNLSKAFQIWWRRSFLR 535 >OAY36085.1 hypothetical protein MANES_12G154700 [Manihot esculenta] Length = 546 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLS+AFQIWWRRS R Sbjct: 507 EWFRCFSKRGTECPNLSKAFQIWWRRSFLR 536 >KDO58322.1 hypothetical protein CISIN_1g041685mg, partial [Citrus sinensis] Length = 549 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLS+AFQIWWRRS R Sbjct: 510 EWFHCFSKHGTECPNLSKAFQIWWRRSFLR 539 >XP_017969614.1 PREDICTED: BTB/POZ domain-containing protein At2g13690 [Theobroma cacao] Length = 550 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLS+AFQIWWRRS R Sbjct: 511 EWFRCFSKHGTECPNLSKAFQIWWRRSFLR 540 >XP_010467198.1 PREDICTED: BTB/POZ domain-containing protein At2g13690-like [Camelina sativa] Length = 550 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/30 (80%), Positives = 25/30 (83%) Frame = +3 Query: 3 EWFGCFSGCGTECPNLSRAFQIWWRRSCTR 92 EWF CFS GTECPNLS+AFQIWWRRS R Sbjct: 513 EWFRCFSKHGTECPNLSKAFQIWWRRSFLR 542