BLASTX nr result
ID: Magnolia22_contig00025862
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00025862 (307 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EQB57769.1 hypothetical protein CGLO_02068 [Colletotrichum gloeo... 119 3e-29 XP_007287027.1 alcohol oxidase [Colletotrichum gloeosporioides N... 119 3e-29 ENH84998.1 alcohol oxidase [Colletotrichum orbiculare MAFF 240422] 105 3e-24 OLN87382.1 Alcohol oxidase 1 [Colletotrichum chlorophyti] 101 5e-23 CCF36001.1 alcohol oxidase, partial [Colletotrichum higginsianum] 100 2e-22 XP_018150812.1 GMC oxidoreductase [Colletotrichum higginsianum I... 100 2e-22 KZL85373.1 alcohol oxidase [Colletotrichum incanum] OHX00531.1 a... 100 2e-22 OHF00446.1 GMC oxidoreductase [Colletotrichum orchidophilum] 100 3e-22 KXH64569.1 GMC oxidoreductase [Colletotrichum nymphaeae SA-01] 100 3e-22 KXH52220.1 GMC oxidoreductase [Colletotrichum simmondsii] 100 3e-22 KDN64132.1 putative GMC oxidoreductase [Colletotrichum sublineola] 100 3e-22 XP_007594728.1 GMC oxidoreductase [Colletotrichum fioriniae PJ7]... 100 3e-22 XP_008098795.1 GMC oxidoreductase [Colletotrichum graminicola M1... 100 3e-22 KZL69289.1 alcohol oxidase (GMC oxidoreductase), partial [Collet... 100 3e-22 KXH68751.1 GMC oxidoreductase [Colletotrichum salicis] 100 3e-22 XP_013331372.1 Alcohol oxidase [Rasamsonia emersonii CBS 393.64]... 99 5e-22 XP_003002254.1 alcohol oxidase [Verticillium alfalfae VaMs.102] ... 99 7e-22 XP_009656839.1 alcohol oxidase [Verticillium dahliae VdLs.17] EG... 99 7e-22 CRK14156.1 hypothetical protein BN1708_017233 [Verticillium long... 99 7e-22 CRK08947.1 hypothetical protein BN1708_009848 [Verticillium long... 99 7e-22 >EQB57769.1 hypothetical protein CGLO_02068 [Colletotrichum gloeosporioides Cg-14] Length = 670 Score = 119 bits (298), Expect = 3e-29 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFIQPTARL 137 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFIQPTARL Sbjct: 614 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFIQPTARL 670 >XP_007287027.1 alcohol oxidase [Colletotrichum gloeosporioides Nara gc5] ELA23919.1 alcohol oxidase [Colletotrichum gloeosporioides Nara gc5] Length = 670 Score = 119 bits (298), Expect = 3e-29 Identities = 57/57 (100%), Positives = 57/57 (100%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFIQPTARL 137 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFIQPTARL Sbjct: 614 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFIQPTARL 670 >ENH84998.1 alcohol oxidase [Colletotrichum orbiculare MAFF 240422] Length = 669 Score = 105 bits (261), Expect = 3e-24 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPTYHAPGEFV 664 >OLN87382.1 Alcohol oxidase 1 [Colletotrichum chlorophyti] Length = 669 Score = 101 bits (252), Expect = 5e-23 Identities = 50/57 (87%), Positives = 52/57 (91%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFIQPTARL 137 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ TARL Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAVLVAEDLGYSGEALEMKVPTYHAPGEFVL-TARL 669 >CCF36001.1 alcohol oxidase, partial [Colletotrichum higginsianum] Length = 507 Score = 100 bits (248), Expect = 2e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 452 SICPDNVGCNTYSTALLIGEKAAVLVAEDLGYSGEALEMKVPTYHAPGEFV 502 >XP_018150812.1 GMC oxidoreductase [Colletotrichum higginsianum IMI 349063] OBR02294.1 GMC oxidoreductase [Colletotrichum higginsianum IMI 349063] Length = 669 Score = 100 bits (248), Expect = 2e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAVLVAEDLGYSGEALEMKVPTYHAPGEFV 664 >KZL85373.1 alcohol oxidase [Colletotrichum incanum] OHX00531.1 alcohol oxidase [Colletotrichum incanum] Length = 669 Score = 100 bits (248), Expect = 2e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAVLVAEDLGYSGEALEMKVPTYHAPGEFV 664 >OHF00446.1 GMC oxidoreductase [Colletotrichum orchidophilum] Length = 669 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGQALEMKVPTYHAPGEFV 664 >KXH64569.1 GMC oxidoreductase [Colletotrichum nymphaeae SA-01] Length = 669 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGEALEMKVPTYHAPGEFV 664 >KXH52220.1 GMC oxidoreductase [Colletotrichum simmondsii] Length = 669 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGEALEMKVPTYHAPGEFV 664 >KDN64132.1 putative GMC oxidoreductase [Colletotrichum sublineola] Length = 669 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAALLVAEDLGYSGEALEMKVPTYHAPGEFV 664 >XP_007594728.1 GMC oxidoreductase [Colletotrichum fioriniae PJ7] EXF81616.1 GMC oxidoreductase [Colletotrichum fioriniae PJ7] Length = 669 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGEALEMKVPTYHAPGEFV 664 >XP_008098795.1 GMC oxidoreductase [Colletotrichum graminicola M1.001] EFQ34775.1 GMC oxidoreductase [Colletotrichum graminicola M1.001] Length = 669 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 614 SICPDNVGCNTYSTALLIGEKAAILVAEDLGYSGEALEMKVPTYHAPGEFV 664 >KZL69289.1 alcohol oxidase (GMC oxidoreductase), partial [Colletotrichum tofieldiae] Length = 674 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 619 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGEALEMKVPTYHAPGEFV 669 >KXH68751.1 GMC oxidoreductase [Colletotrichum salicis] Length = 679 Score = 99.8 bits (247), Expect = 3e-22 Identities = 46/51 (90%), Positives = 48/51 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEFI 155 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG ALEM+VP YHAPGEF+ Sbjct: 624 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGEALEMKVPTYHAPGEFV 674 >XP_013331372.1 Alcohol oxidase [Rasamsonia emersonii CBS 393.64] KKA24760.1 Alcohol oxidase [Rasamsonia emersonii CBS 393.64] Length = 674 Score = 99.0 bits (245), Expect = 5e-22 Identities = 45/49 (91%), Positives = 47/49 (95%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGE 161 SICPDNVGCNTYSTALL+GEKAA L AEDLGYSG+ALEMRVPNYHAPGE Sbjct: 607 SICPDNVGCNTYSTALLVGEKAAVLTAEDLGYSGSALEMRVPNYHAPGE 655 >XP_003002254.1 alcohol oxidase [Verticillium alfalfae VaMs.102] EEY21603.1 alcohol oxidase [Verticillium alfalfae VaMs.102] Length = 647 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEF 158 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG AL M+VPNYHAPGEF Sbjct: 592 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGDALNMKVPNYHAPGEF 641 >XP_009656839.1 alcohol oxidase [Verticillium dahliae VdLs.17] EGY19381.1 alcohol oxidase [Verticillium dahliae VdLs.17] Length = 649 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEF 158 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG AL M+VPNYHAPGEF Sbjct: 594 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGDALNMKVPNYHAPGEF 643 >CRK14156.1 hypothetical protein BN1708_017233 [Verticillium longisporum] Length = 662 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEF 158 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG AL M+VPNYHAPGEF Sbjct: 607 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGDALNMKVPNYHAPGEF 656 >CRK08947.1 hypothetical protein BN1708_009848 [Verticillium longisporum] Length = 663 Score = 98.6 bits (244), Expect = 7e-22 Identities = 46/50 (92%), Positives = 47/50 (94%) Frame = -1 Query: 307 SICPDNVGCNTYSTALLIGEKAATLVAEDLGYSGAALEMRVPNYHAPGEF 158 SICPDNVGCNTYSTALLIGEKAA LVAEDLGYSG AL M+VPNYHAPGEF Sbjct: 608 SICPDNVGCNTYSTALLIGEKAAMLVAEDLGYSGDALNMKVPNYHAPGEF 657