BLASTX nr result
ID: Magnolia22_contig00025856
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00025856 (324 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007673108.1 hypothetical protein BAUCODRAFT_63557 [Baudoinia ... 69 1e-11 KXL44998.1 hypothetical protein FE78DRAFT_40419 [Acidomyces rich... 54 3e-06 >XP_007673108.1 hypothetical protein BAUCODRAFT_63557 [Baudoinia panamericana UAMH 10762] EMC99562.1 hypothetical protein BAUCODRAFT_63557 [Baudoinia panamericana UAMH 10762] Length = 258 Score = 68.6 bits (166), Expect = 1e-11 Identities = 31/43 (72%), Positives = 35/43 (81%), Gaps = 2/43 (4%) Frame = +3 Query: 3 RPSIGPYAEAGD--NKQMAKNGYAVPENQFDYDTGYHGGHEAR 125 RPS+GPYAE D +K M + GY+VPENQFDYDTGYHGGHE R Sbjct: 213 RPSMGPYAEQRDVADKAMHQQGYSVPENQFDYDTGYHGGHEER 255 >KXL44998.1 hypothetical protein FE78DRAFT_40419 [Acidomyces richmondensis] KYG40431.1 hypothetical protein M433DRAFT_28193 [Acidomyces richmondensis BFW] Length = 251 Score = 53.9 bits (128), Expect = 3e-06 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = +3 Query: 9 SIGPYAEAGDNKQMAKNGYAVPENQFDYDTGYHGGHEAR 125 S YAE +K + + GYAVPE QF+YDTGYHGGH R Sbjct: 213 SFAQYAERTGDKSIEQQGYAVPEAQFEYDTGYHGGHAER 251