BLASTX nr result
ID: Magnolia22_contig00025799
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00025799 (482 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_017632555.1 PREDICTED: ribose-phosphate pyrophosphokinase 2, ... 65 1e-09 XP_006368438.1 hypothetical protein POPTR_0001s02860g [Populus t... 65 1e-09 XP_006385616.1 Ribose-phosphate pyrophosphokinase 2 family prote... 65 2e-09 AQK68110.1 Ribose-phosphate pyrophosphokinase [Zea mays] 63 4e-09 OEL28379.1 Ribose-phosphate pyrophosphokinase 1 [Dichanthelium o... 62 1e-08 GAU24807.1 hypothetical protein TSUD_157200 [Trifolium subterran... 63 1e-08 OIW10315.1 hypothetical protein TanjilG_28066 [Lupinus angustifo... 63 1e-08 OIV93420.1 hypothetical protein TanjilG_02957 [Lupinus angustifo... 63 1e-08 BAS76782.1 Os02g0127700 [Oryza sativa Japonica Group] 62 1e-08 KYP55278.1 Ribose-phosphate pyrophosphokinase 1 [Cajanus cajan] 63 1e-08 KHN01672.1 Ribose-phosphate pyrophosphokinase 1, chloroplastic [... 63 1e-08 OMO90129.1 hypothetical protein COLO4_19348 [Corchorus olitorius] 63 1e-08 EMT06802.1 Ribose-phosphate pyrophosphokinase 1 [Aegilops tauschii] 63 1e-08 XP_008784666.1 PREDICTED: ribose-phosphate pyrophosphokinase 1 i... 62 2e-08 KRH48939.1 hypothetical protein GLYMA_07G122000 [Glycine max] 62 2e-08 XP_006437314.1 hypothetical protein CICLE_v10031791mg [Citrus cl... 61 2e-08 XP_006437315.1 hypothetical protein CICLE_v10031791mg [Citrus cl... 61 2e-08 KDO53829.1 hypothetical protein CISIN_1g018472mg [Citrus sinensis] 62 2e-08 XP_008784665.1 PREDICTED: ribose-phosphate pyrophosphokinase 1 i... 62 2e-08 JAU12630.1 Ribose-phosphate pyrophosphokinase 1, chloroplastic, ... 59 2e-08 >XP_017632555.1 PREDICTED: ribose-phosphate pyrophosphokinase 2, chloroplastic-like [Gossypium arboreum] Length = 248 Score = 65.1 bits (157), Expect = 1e-09 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVSF 97 IMIDACRRASAKNITAVIPYFGYARA+RKVSF Sbjct: 125 IMIDACRRASAKNITAVIPYFGYARANRKVSF 156 >XP_006368438.1 hypothetical protein POPTR_0001s02860g [Populus trichocarpa] ERP65007.1 hypothetical protein POPTR_0001s02860g [Populus trichocarpa] Length = 375 Score = 65.5 bits (158), Expect = 1e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVSF 97 IMIDACRRASAKNITAVIPYFGYARADRK SF Sbjct: 129 IMIDACRRASAKNITAVIPYFGYARADRKASF 160 >XP_006385616.1 Ribose-phosphate pyrophosphokinase 2 family protein [Populus trichocarpa] ERP63413.1 Ribose-phosphate pyrophosphokinase 2 family protein [Populus trichocarpa] Length = 377 Score = 65.5 bits (158), Expect = 2e-09 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVSF 97 IMIDACRRASAKNITAVIPYFGYARADRK SF Sbjct: 126 IMIDACRRASAKNITAVIPYFGYARADRKASF 157 >AQK68110.1 Ribose-phosphate pyrophosphokinase [Zea mays] Length = 222 Score = 63.2 bits (152), Expect = 4e-09 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKV 91 IMIDACRRASAKNITAVIPYFGYARADRKV Sbjct: 151 IMIDACRRASAKNITAVIPYFGYARADRKV 180 >OEL28379.1 Ribose-phosphate pyrophosphokinase 1 [Dichanthelium oligosanthes] Length = 218 Score = 62.0 bits (149), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKV 91 IMIDACRRASAKNITAVIPYFGYARADRK+ Sbjct: 5 IMIDACRRASAKNITAVIPYFGYARADRKM 34 >GAU24807.1 hypothetical protein TSUD_157200 [Trifolium subterraneum] Length = 375 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVS 94 IMIDACRRASAKNITAVIPYFGYARADRK S Sbjct: 128 IMIDACRRASAKNITAVIPYFGYARADRKAS 158 >OIW10315.1 hypothetical protein TanjilG_28066 [Lupinus angustifolius] Length = 394 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVS 94 IMIDACRRASAKNITAVIPYFGYARADRK S Sbjct: 159 IMIDACRRASAKNITAVIPYFGYARADRKAS 189 >OIV93420.1 hypothetical protein TanjilG_02957 [Lupinus angustifolius] Length = 400 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVS 94 IMIDACRRASAKNITAVIPYFGYARADRK S Sbjct: 156 IMIDACRRASAKNITAVIPYFGYARADRKAS 186 >BAS76782.1 Os02g0127700 [Oryza sativa Japonica Group] Length = 197 Score = 61.6 bits (148), Expect = 1e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 IMIDACRRASAKNITAVIPYFGYARADRK Sbjct: 148 IMIDACRRASAKNITAVIPYFGYARADRK 176 >KYP55278.1 Ribose-phosphate pyrophosphokinase 1 [Cajanus cajan] Length = 407 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVS 94 IMIDACRRASAKNITAVIPYFGYARADRK S Sbjct: 149 IMIDACRRASAKNITAVIPYFGYARADRKAS 179 >KHN01672.1 Ribose-phosphate pyrophosphokinase 1, chloroplastic [Glycine soja] Length = 419 Score = 63.2 bits (152), Expect = 1e-08 Identities = 30/31 (96%), Positives = 30/31 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKVS 94 IMIDACRRASAKNITAVIPYFGYARADRK S Sbjct: 163 IMIDACRRASAKNITAVIPYFGYARADRKAS 193 >OMO90129.1 hypothetical protein COLO4_19348 [Corchorus olitorius] Length = 411 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKV 91 IM+DACRRASAKNITAVIPYFGYARADRKV Sbjct: 146 IMVDACRRASAKNITAVIPYFGYARADRKV 175 >EMT06802.1 Ribose-phosphate pyrophosphokinase 1 [Aegilops tauschii] Length = 447 Score = 62.8 bits (151), Expect = 1e-08 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRKV 91 IMIDACRRASAKNITAVIPYFGYARADRK+ Sbjct: 117 IMIDACRRASAKNITAVIPYFGYARADRKI 146 >XP_008784666.1 PREDICTED: ribose-phosphate pyrophosphokinase 1 isoform X2 [Phoenix dactylifera] Length = 232 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 IMIDACRRASAKNITAVIPYFGYARADRK Sbjct: 5 IMIDACRRASAKNITAVIPYFGYARADRK 33 >KRH48939.1 hypothetical protein GLYMA_07G122000 [Glycine max] Length = 235 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 IMIDACRRASAKNITAVIPYFGYARADRK Sbjct: 154 IMIDACRRASAKNITAVIPYFGYARADRK 182 >XP_006437314.1 hypothetical protein CICLE_v10031791mg [Citrus clementina] ESR50554.1 hypothetical protein CICLE_v10031791mg [Citrus clementina] Length = 208 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 +MIDACRRASAKNITAVIPYFGYARADRK Sbjct: 50 VMIDACRRASAKNITAVIPYFGYARADRK 78 >XP_006437315.1 hypothetical protein CICLE_v10031791mg [Citrus clementina] ESR50555.1 hypothetical protein CICLE_v10031791mg [Citrus clementina] Length = 209 Score = 61.2 bits (147), Expect = 2e-08 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 +MIDACRRASAKNITAVIPYFGYARADRK Sbjct: 50 VMIDACRRASAKNITAVIPYFGYARADRK 78 >KDO53829.1 hypothetical protein CISIN_1g018472mg [Citrus sinensis] Length = 238 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 IMIDACRRASAKNITAVIPYFGYARADRK Sbjct: 50 IMIDACRRASAKNITAVIPYFGYARADRK 78 >XP_008784665.1 PREDICTED: ribose-phosphate pyrophosphokinase 1 isoform X1 [Phoenix dactylifera] Length = 247 Score = 61.6 bits (148), Expect = 2e-08 Identities = 29/29 (100%), Positives = 29/29 (100%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 IMIDACRRASAKNITAVIPYFGYARADRK Sbjct: 5 IMIDACRRASAKNITAVIPYFGYARADRK 33 >JAU12630.1 Ribose-phosphate pyrophosphokinase 1, chloroplastic, partial [Noccaea caerulescens] JAU73847.1 Ribose-phosphate pyrophosphokinase 1, chloroplastic, partial [Noccaea caerulescens] Length = 105 Score = 58.9 bits (141), Expect = 2e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +2 Query: 2 IMIDACRRASAKNITAVIPYFGYARADRK 88 IMIDACRRASAK +TAVIPYFGYARADRK Sbjct: 68 IMIDACRRASAKKVTAVIPYFGYARADRK 96