BLASTX nr result
ID: Magnolia22_contig00025742
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00025742 (370 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KCW56103.1 hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] 67 1e-11 KMT03782.1 hypothetical protein BVRB_8g189280 isoform B [Beta vu... 65 1e-09 EEF45989.1 conserved hypothetical protein [Ricinus communis] 56 1e-07 >KCW56103.1 hypothetical protein EUGRSUZ_I01857 [Eucalyptus grandis] Length = 143 Score = 67.0 bits (162), Expect = 1e-11 Identities = 58/119 (48%), Positives = 62/119 (52%), Gaps = 6/119 (5%) Frame = -3 Query: 341 RVRGEATKLKASLARSIRSNARLVDSKWSS*AQQLQGRGLTTRARKSSTE-----RALST 177 R RG ATKLKASLARS NA L DS+WS+ A G L + E RA S Sbjct: 2 RERGGATKLKASLARS---NAHLGDSEWSAEAPLEIGGVLHELVSQVRNEPCLQSRATSA 58 Query: 176 KLRFLVLLASGEASSTI**AFWYGRNTNLKADHYIGAIAKPSRQKASSPY-SNSKRPTY 3 L LL S+I T YIGAIAKPSR KASSPY SNSKRPTY Sbjct: 59 CLLLAKLLELDNKHSSIVKRLLIRPTTT-----YIGAIAKPSRIKASSPYSSNSKRPTY 112 >KMT03782.1 hypothetical protein BVRB_8g189280 isoform B [Beta vulgaris subsp. vulgaris] Length = 1629 Score = 64.7 bits (156), Expect = 1e-09 Identities = 39/57 (68%), Positives = 42/57 (73%) Frame = +1 Query: 136 EASPEASKTRKRSFVDKARSVLDLRARVVRPRPCSCWAYELHLLSTKRALERIERAS 306 E SPEASKTR FVDKARSVLDL+ARVV S AY L+LLSTKRALER + S Sbjct: 1236 EVSPEASKTRSLCFVDKARSVLDLQARVVL-ASISKGAYALYLLSTKRALERAKNYS 1291 >EEF45989.1 conserved hypothetical protein [Ricinus communis] Length = 103 Score = 55.8 bits (133), Expect = 1e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -3 Query: 86 ADHYIGAIAKPSRQKASSPYSNSKRPTY 3 +DHYIGAIAKPSR KAS+PYSNSKRPTY Sbjct: 31 SDHYIGAIAKPSRIKASNPYSNSKRPTY 58