BLASTX nr result
ID: Magnolia22_contig00024109
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00024109 (394 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018822112.1 PREDICTED: pentatricopeptide repeat-containing pr... 120 3e-32 ONK63061.1 uncharacterized protein A4U43_C07F11010 [Asparagus of... 122 4e-32 KHN03231.1 Pentatricopeptide repeat-containing protein, partial ... 117 5e-32 XP_008390483.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 6e-32 XP_008223521.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 2e-31 XP_009417773.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 2e-31 XP_009369706.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 2e-31 XP_009359788.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 2e-31 XP_017608210.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 3e-31 XP_012487551.1 PREDICTED: pentatricopeptide repeat-containing pr... 126 3e-31 XP_016723197.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 4e-31 XP_016718835.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 4e-31 XP_007226779.1 hypothetical protein PRUPE_ppa018015mg [Prunus pe... 125 5e-31 XP_008790494.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 7e-31 XP_019245548.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 1e-30 XP_009795612.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 124 1e-30 XP_016463843.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 1e-30 XP_009618113.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 1e-30 XP_007035985.2 PREDICTED: pentatricopeptide repeat-containing pr... 124 1e-30 XP_016458331.1 PREDICTED: pentatricopeptide repeat-containing pr... 124 1e-30 >XP_018822112.1 PREDICTED: pentatricopeptide repeat-containing protein At5g06540-like [Juglans regia] Length = 145 Score = 120 bits (300), Expect = 3e-32 Identities = 52/68 (76%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PG T+RI+KNLRVC+DCH+ +KLISKV+DR+I+VRDR+RFHHF G Sbjct: 78 SEKLAIAFGLLKTKPGETLRITKNLRVCKDCHNVTKLISKVYDRQIIVRDRNRFHHFRMG 137 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 138 ECSCKDYW 145 >ONK63061.1 uncharacterized protein A4U43_C07F11010 [Asparagus officinalis] Length = 241 Score = 122 bits (306), Expect = 4e-32 Identities = 54/68 (79%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAI +GLL T PG TIRISKNLRVC+DCH+ASK+IS+ +DREIVVRDR+RFHHF GG Sbjct: 174 SEKLAIGFGLLKTKPGETIRISKNLRVCKDCHYASKIISRAYDREIVVRDRNRFHHFRGG 233 Query: 212 ECSCKDYW 189 CSCKDYW Sbjct: 234 VCSCKDYW 241 >KHN03231.1 Pentatricopeptide repeat-containing protein, partial [Glycine soja] Length = 92 Score = 117 bits (294), Expect = 5e-32 Identities = 50/68 (73%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLA+AYGLL T G T+R++KNLRVC+DCH ASK+ISKV+D +I++RDRSRFH+FS G Sbjct: 25 SEKLAVAYGLLKTKRGETLRVTKNLRVCKDCHQASKMISKVYDYDIIIRDRSRFHYFSNG 84 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 85 ECSCKDYW 92 >XP_008390483.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Malus domestica] Length = 627 Score = 128 bits (321), Expect = 6e-32 Identities = 58/68 (85%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIAYGLL T P T+RISKNLRVC+DCH ASKLISKVFDREI+VRDR+RFHHF GG Sbjct: 560 SEKLAIAYGLLKTKPRETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKGG 619 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 620 ECSCKDYW 627 >XP_008223521.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Prunus mume] Length = 624 Score = 126 bits (317), Expect = 2e-31 Identities = 57/68 (83%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PG T+RISKNLRVC+DCH ASKLISKVFDREI+VRDR+RFHHF G Sbjct: 557 SEKLAIAFGLLKTKPGETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKRG 616 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 617 ECSCKDYW 624 >XP_009417773.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Musa acuminata subsp. malaccensis] Length = 625 Score = 126 bits (317), Expect = 2e-31 Identities = 57/68 (83%), Positives = 63/68 (92%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLLNT G TIRI+KNLRVCRDCH ASKL+SKVFDREI+VRDR+RFHHF GG Sbjct: 558 SEKLAIAFGLLNTRSGDTIRITKNLRVCRDCHAASKLVSKVFDREIIVRDRNRFHHFMGG 617 Query: 212 ECSCKDYW 189 ECSC+DYW Sbjct: 618 ECSCRDYW 625 >XP_009369706.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Pyrus x bretschneideri] Length = 627 Score = 126 bits (317), Expect = 2e-31 Identities = 57/68 (83%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T P T+RISKNLRVC+DCH ASKLISKVFDREI+VRDR+RFHHF GG Sbjct: 560 SEKLAIAFGLLKTKPRETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKGG 619 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 620 ECSCKDYW 627 >XP_009359788.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Pyrus x bretschneideri] Length = 627 Score = 126 bits (317), Expect = 2e-31 Identities = 57/68 (83%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T P T+RISKNLRVC+DCH ASKLISKVFDREI+VRDR+RFHHF GG Sbjct: 560 SEKLAIAFGLLKTKPRETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKGG 619 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 620 ECSCKDYW 627 >XP_017608210.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium arboreum] Length = 630 Score = 126 bits (316), Expect = 3e-31 Identities = 58/68 (85%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T G T RI+KNLRVCRDCHHASKLISKVFDREIVVRDR+RFHHF G Sbjct: 563 SEKLAIAFGLLKTKAGDTFRITKNLRVCRDCHHASKLISKVFDREIVVRDRNRFHHFKDG 622 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 623 ECSCKDYW 630 >XP_012487551.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium raimondii] KJB38678.1 hypothetical protein B456_006G266600 [Gossypium raimondii] Length = 630 Score = 126 bits (316), Expect = 3e-31 Identities = 58/68 (85%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T G T RI+KNLRVCRDCHHASKLISKVFDREIVVRDR+RFHHF G Sbjct: 563 SEKLAIAFGLLKTKAGDTFRITKNLRVCRDCHHASKLISKVFDREIVVRDRNRFHHFKDG 622 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 623 ECSCKDYW 630 >XP_016723197.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium hirsutum] Length = 630 Score = 125 bits (315), Expect = 4e-31 Identities = 57/68 (83%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T G T RI+KNLRVCRDCHHASKL+SKVFDREIVVRDR+RFHHF G Sbjct: 563 SEKLAIAFGLLKTKAGDTFRITKNLRVCRDCHHASKLVSKVFDREIVVRDRNRFHHFKDG 622 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 623 ECSCKDYW 630 >XP_016718835.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Gossypium hirsutum] Length = 630 Score = 125 bits (315), Expect = 4e-31 Identities = 57/68 (83%), Positives = 61/68 (89%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T G T RI+KNLRVCRDCHHASKL+SKVFDREIVVRDR+RFHHF G Sbjct: 563 SEKLAIAFGLLKTKAGDTFRITKNLRVCRDCHHASKLVSKVFDREIVVRDRNRFHHFKDG 622 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 623 ECSCKDYW 630 >XP_007226779.1 hypothetical protein PRUPE_ppa018015mg [Prunus persica] ONI27803.1 hypothetical protein PRUPE_1G105500 [Prunus persica] Length = 624 Score = 125 bits (314), Expect = 5e-31 Identities = 56/68 (82%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PG T+RISKNLRVC+DCH ASKLISKVFDREI+VRDR+RFHHF G Sbjct: 557 SEKLAIAFGLLKTKPGETLRISKNLRVCKDCHQASKLISKVFDREIIVRDRNRFHHFKRG 616 Query: 212 ECSCKDYW 189 +CSCKDYW Sbjct: 617 DCSCKDYW 624 >XP_008790494.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Phoenix dactylifera] Length = 632 Score = 125 bits (313), Expect = 7e-31 Identities = 56/68 (82%), Positives = 63/68 (92%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL+T G TIRISKNLRVCRDCH ASK+IS+VFDREI+VRDR+RFHHF GG Sbjct: 565 SEKLAIAFGLLHTRSGETIRISKNLRVCRDCHAASKIISRVFDREIIVRDRNRFHHFKGG 624 Query: 212 ECSCKDYW 189 ECSC+DYW Sbjct: 625 ECSCRDYW 632 >XP_019245548.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana attenuata] OIT03240.1 pentatricopeptide repeat-containing protein [Nicotiana attenuata] Length = 626 Score = 124 bits (312), Expect = 1e-30 Identities = 55/68 (80%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PGA +RI+KNLRVC+DCH ASKLISKV+DREI+VRDR+RFHHF G Sbjct: 559 SEKLAIAFGLLKTKPGAVLRITKNLRVCKDCHQASKLISKVYDREIIVRDRNRFHHFKDG 618 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 619 ECSCKDYW 626 >XP_009795612.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana sylvestris] Length = 626 Score = 124 bits (312), Expect = 1e-30 Identities = 55/68 (80%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PGA +RI+KNLRVC+DCH ASKLISKV+DREI+VRDR+RFHHF G Sbjct: 559 SEKLAIAFGLLKTKPGAVLRITKNLRVCKDCHQASKLISKVYDREIIVRDRNRFHHFKDG 618 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 619 ECSCKDYW 626 >XP_016463843.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tabacum] XP_016463844.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tabacum] Length = 627 Score = 124 bits (312), Expect = 1e-30 Identities = 55/68 (80%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PGA +RI+KNLRVC+DCH ASKLISKV+DREI+VRDR+RFHHF G Sbjct: 560 SEKLAIAFGLLKTKPGAVLRITKNLRVCKDCHQASKLISKVYDREIIVRDRNRFHHFKDG 619 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 620 ECSCKDYW 627 >XP_009618113.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Nicotiana tomentosiformis] XP_009618114.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Nicotiana tomentosiformis] Length = 627 Score = 124 bits (312), Expect = 1e-30 Identities = 55/68 (80%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PGA +RI+KNLRVC+DCH ASKLISKV+DREI+VRDR+RFHHF G Sbjct: 560 SEKLAIAFGLLKTKPGAVLRITKNLRVCKDCHQASKLISKVYDREIIVRDRNRFHHFKDG 619 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 620 ECSCKDYW 627 >XP_007035985.2 PREDICTED: pentatricopeptide repeat-containing protein At5g66520 [Theobroma cacao] Length = 628 Score = 124 bits (312), Expect = 1e-30 Identities = 57/68 (83%), Positives = 60/68 (88%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA GLL T G T RI+KNLRVCRDCHHASKLISKVFDREI+VRDR+RFHHF G Sbjct: 561 SEKLAIALGLLKTKTGETFRITKNLRVCRDCHHASKLISKVFDREIIVRDRNRFHHFKDG 620 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 621 ECSCKDYW 628 >XP_016458331.1 PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Nicotiana tabacum] Length = 628 Score = 124 bits (312), Expect = 1e-30 Identities = 55/68 (80%), Positives = 62/68 (91%) Frame = -3 Query: 392 SEKLAIAYGLLNTGPGATIRISKNLRVCRDCHHASKLISKVFDREIVVRDRSRFHHFSGG 213 SEKLAIA+GLL T PGA +RI+KNLRVC+DCH ASKLISKV+DREI+VRDR+RFHHF G Sbjct: 561 SEKLAIAFGLLKTKPGAVLRITKNLRVCKDCHQASKLISKVYDREIIVRDRNRFHHFKDG 620 Query: 212 ECSCKDYW 189 ECSCKDYW Sbjct: 621 ECSCKDYW 628