BLASTX nr result
ID: Magnolia22_contig00024020
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00024020 (614 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFX98072.1 phenylalanine ammonia lyase [Cunninghamia lanceolata] 87 3e-16 CAL25301.1 phenylalanine ammonia-lyase, partial [Picea abies] 79 4e-16 AFR41214.1 phenylalanine ammonia-lyase, partial [Populus trichoc... 79 7e-16 AFR41220.1 phenylalanine ammonia-lyase, partial [Populus trichoc... 79 1e-15 AFR41221.1 phenylalanine ammonia-lyase, partial [Populus fremont... 79 1e-15 AFR41218.1 phenylalanine ammonia-lyase, partial [Populus trichoc... 79 1e-15 AFR41211.1 phenylalanine ammonia-lyase, partial [Populus trichoc... 79 1e-15 AFR41227.1 phenylalanine ammonia-lyase, partial [Populus fremontii] 77 2e-15 AFR41231.1 phenylalanine ammonia-lyase, partial [Populus nigra] 77 2e-15 AFR41233.1 phenylalanine ammonia-lyase, partial [Populus nigra] 77 2e-15 AFR41238.1 phenylalanine ammonia-lyase, partial [Populus nigra] 77 2e-15 JAT42084.1 Phenylalanine ammonia-lyase, partial [Anthurium amnic... 82 3e-15 AFR41239.1 phenylalanine ammonia-lyase, partial [Populus nigra] 77 3e-15 AFR41236.1 phenylalanine ammonia-lyase, partial [Populus nigra] 77 3e-15 AFR41237.1 phenylalanine ammonia-lyase, partial [Populus nigra] 77 6e-15 AFR41234.1 phenylalanine ammonia-lyase, partial [Populus nigra] ... 77 6e-15 AFR41232.1 phenylalanine ammonia-lyase, partial [Populus nigra] 77 6e-15 AFR41235.1 phenylalanine ammonia-lyase, partial [Populus nigra] 75 1e-14 BAD95069.1 phenylalanine ammonia lyase, partial [Arabidopsis tha... 76 2e-14 JAU31907.1 Phenylalanine ammonia-lyase 3, partial [Noccaea caeru... 75 2e-14 >AFX98072.1 phenylalanine ammonia lyase [Cunninghamia lanceolata] Length = 709 Score = 86.7 bits (213), Expect = 3e-16 Identities = 36/52 (69%), Positives = 48/52 (92%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVRSEL+TS+L+GTK SPG+DFDKV +AIN+GKL++PLL C++GW+G Sbjct: 653 PLYEFVRSELETSILAGTKSRSPGQDFDKVLIAINEGKLVEPLLKCVEGWNG 704 >CAL25301.1 phenylalanine ammonia-lyase, partial [Picea abies] Length = 65 Score = 79.0 bits (193), Expect = 4e-16 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL GT SPGEDFDKVFVAIN+GK ++PL CL+ W+G Sbjct: 9 PLYEFVRLELGTSLLVGTNSNSPGEDFDKVFVAINEGKAVEPLFKCLERWNG 60 >AFR41214.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] Length = 99 Score = 79.3 bits (194), Expect = 7e-16 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL WDG Sbjct: 42 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG 93 >AFR41220.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] Length = 117 Score = 79.3 bits (194), Expect = 1e-15 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL WDG Sbjct: 60 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG 111 >AFR41221.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41222.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41223.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41224.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41225.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41226.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41228.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41229.1 phenylalanine ammonia-lyase, partial [Populus fremontii] AFR41230.1 phenylalanine ammonia-lyase, partial [Populus fremontii] Length = 118 Score = 79.3 bits (194), Expect = 1e-15 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL WDG Sbjct: 61 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG 112 >AFR41218.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] Length = 118 Score = 79.3 bits (194), Expect = 1e-15 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL WDG Sbjct: 61 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG 112 >AFR41211.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] AFR41212.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] AFR41213.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] AFR41215.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] AFR41216.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] AFR41217.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] AFR41219.1 phenylalanine ammonia-lyase, partial [Populus trichocarpa] Length = 120 Score = 79.3 bits (194), Expect = 1e-15 Identities = 38/52 (73%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL WDG Sbjct: 63 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG 114 >AFR41227.1 phenylalanine ammonia-lyase, partial [Populus fremontii] Length = 77 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/52 (71%), Positives = 41/52 (78%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL T LL+G K+ SPGE+FDKVF AI GKLIDPLL CL WDG Sbjct: 20 PLYKFVREELGTXLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWDG 71 >AFR41231.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 80 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 23 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 74 >AFR41233.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 81 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 24 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 75 >AFR41238.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 84 Score = 77.4 bits (189), Expect = 2e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 27 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 78 >JAT42084.1 Phenylalanine ammonia-lyase, partial [Anthurium amnicola] Length = 303 Score = 82.4 bits (202), Expect = 3e-15 Identities = 36/52 (69%), Positives = 44/52 (84%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 P+YQFVRSELK LLSG K SPGEDFD VFVA++DG+++D LL+CL+ WDG Sbjct: 246 PIYQFVRSELKIGLLSGAKTRSPGEDFDMVFVALSDGRIVDSLLSCLEEWDG 297 >AFR41239.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 86 Score = 77.4 bits (189), Expect = 3e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 29 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 80 >AFR41236.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 91 Score = 77.4 bits (189), Expect = 3e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 34 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 85 >AFR41237.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 117 Score = 77.4 bits (189), Expect = 6e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 60 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 111 >AFR41234.1 phenylalanine ammonia-lyase, partial [Populus nigra] AFR41240.1 phenylalanine ammonia-lyase, partial [Populus nigra] AFR41241.1 phenylalanine ammonia-lyase, partial [Populus nigra] AFR41242.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 120 Score = 77.4 bits (189), Expect = 6e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 63 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 114 >AFR41232.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 120 Score = 77.4 bits (189), Expect = 6e-15 Identities = 37/52 (71%), Positives = 42/52 (80%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDKVF AI GKLIDPLL CL W+G Sbjct: 63 PLYKFVREELGTSLLTGEKVKSPGEEFDKVFTAICAGKLIDPLLECLKEWNG 114 >AFR41235.1 phenylalanine ammonia-lyase, partial [Populus nigra] Length = 80 Score = 75.5 bits (184), Expect = 1e-14 Identities = 36/52 (69%), Positives = 41/52 (78%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL TSLL+G K+ SPGE+FDK F AI GKLIDPLL CL W+G Sbjct: 23 PLYKFVREELGTSLLTGEKVKSPGEEFDKXFTAICAGKLIDPLLECLKEWNG 74 >BAD95069.1 phenylalanine ammonia lyase, partial [Arabidopsis thaliana] Length = 120 Score = 76.3 bits (186), Expect = 2e-14 Identities = 33/52 (63%), Positives = 43/52 (82%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL T LL+G K+ SPGE+FDKVF AI +GK+IDP++ CL+ W+G Sbjct: 63 PLYRFVREELGTELLTGEKVTSPGEEFDKVFTAICEGKIIDPMMECLNEWNG 114 >JAU31907.1 Phenylalanine ammonia-lyase 3, partial [Noccaea caerulescens] Length = 95 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/52 (65%), Positives = 41/52 (78%) Frame = -3 Query: 516 PLYQFVRSELKTSLLSGTKMLSPGEDFDKVFVAINDGKLIDPLLACLDGWDG 361 PLY+FVR EL+T LL+G + SPGEDFDKV+ AI+ GKLIDPL CL W+G Sbjct: 27 PLYRFVRDELETGLLTGESVGSPGEDFDKVYTAISQGKLIDPLFECLKEWNG 78