BLASTX nr result
ID: Magnolia22_contig00023609
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00023609 (500 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EPS74494.1 hypothetical protein M569_00260, partial [Genlisea au... 79 1e-16 GAU30448.1 hypothetical protein TSUD_392610 [Trifolium subterran... 57 2e-06 >EPS74494.1 hypothetical protein M569_00260, partial [Genlisea aurea] Length = 76 Score = 79.3 bits (194), Expect = 1e-16 Identities = 40/49 (81%), Positives = 43/49 (87%), Gaps = 1/49 (2%) Frame = +1 Query: 214 ATIIPRRSVSCVSWAPDMRRPRANTHRLQHGLPGCLILFAP-AFALQLR 357 AT++PRRSVS VSWAPD RRPRANTHRL+HGLPG LILFAP AFA Q R Sbjct: 28 ATVLPRRSVSRVSWAPDPRRPRANTHRLRHGLPGYLILFAPHAFAPQRR 76 >GAU30448.1 hypothetical protein TSUD_392610 [Trifolium subterraneum] Length = 569 Score = 57.0 bits (136), Expect = 2e-06 Identities = 30/42 (71%), Positives = 31/42 (73%), Gaps = 1/42 (2%) Frame = +1 Query: 235 SVSCVSWAPDMRRPRANTHRLQHGLPGCLILFAP-AFALQLR 357 S + PD RRPRANTHRLQHGLP LILFAP AFALQ R Sbjct: 514 SAKIAALGPDPRRPRANTHRLQHGLPRYLILFAPHAFALQRR 555