BLASTX nr result
ID: Magnolia22_contig00022633
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00022633 (559 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value YP_001109494.1 hypothetical protein Poptr_cp015 [Populus trichoc... 55 4e-07 >YP_001109494.1 hypothetical protein Poptr_cp015 [Populus trichocarpa] ABO36697.1 conserved hypothetical protein (chloroplast) [Populus trichocarpa] Length = 56 Score = 54.7 bits (130), Expect = 4e-07 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +3 Query: 342 K*KKGSASTILSLSNLNIRIADIVMIQWVRSTYFFF 449 K K GS I S+SNL IRI DIVMIQWVRSTYFFF Sbjct: 20 KEKSGSTVPISSISNLTIRIVDIVMIQWVRSTYFFF 55