BLASTX nr result
ID: Magnolia22_contig00022554
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00022554 (428 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007282353.1 integral membrane protein [Colletotrichum gloeosp... 108 2e-27 EQB54209.1 hypothetical protein CGLO_05981 [Colletotrichum gloeo... 105 5e-26 ENH76464.1 integral membrane protein [Colletotrichum orbiculare ... 93 3e-21 KZL65749.1 integral membrane protein [Colletotrichum tofieldiae]... 89 2e-19 XP_008096328.1 hypothetical protein GLRG_07452 [Colletotrichum g... 87 4e-19 KZL68585.1 integral membrane protein, partial [Colletotrichum in... 89 6e-19 OHE91483.1 hypothetical protein CORC01_13216 [Colletotrichum orc... 87 9e-19 KDN66963.1 hypothetical protein CSUB01_08341 [Colletotrichum sub... 86 2e-18 KXH51345.1 hypothetical protein CSAL01_12141 [Colletotrichum sal... 85 3e-18 KXH50331.1 hypothetical protein CSIM01_05389 [Colletotrichum sim... 85 4e-18 XP_007591476.1 hypothetical protein CFIO01_02327 [Colletotrichum... 85 4e-18 XP_018155671.1 Integral membrane protein [Colletotrichum higgins... 81 1e-16 OLN86387.1 hypothetical protein CCHL11_06374 [Colletotrichum chl... 79 6e-16 XP_014545577.1 integral membrane protein, partial [Metarhizium b... 69 6e-12 XP_007819098.1 integral membrane protein [Metarhizium robertsii ... 69 6e-12 KFG78164.1 integral membrane protein [Metarhizium anisopliae] KI... 67 2e-11 XP_018175495.1 integral membrane protein [Purpureocillium lilaci... 66 7e-11 OAQ74757.1 integral membrane protein [Purpureocillium lilacinum] 66 7e-11 XP_007810245.1 integral membrane protein [Metarhizium acridum CQ... 65 1e-10 KXX74413.1 CASP-like protein UU5 [Madurella mycetomatis] 65 2e-10 >XP_007282353.1 integral membrane protein [Colletotrichum gloeosporioides Nara gc5] ELA28617.1 integral membrane protein [Colletotrichum gloeosporioides Nara gc5] Length = 140 Score = 108 bits (269), Expect = 2e-27 Identities = 51/51 (100%), Positives = 51/51 (100%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNSRV 275 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNSRV Sbjct: 90 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNSRV 140 >EQB54209.1 hypothetical protein CGLO_05981 [Colletotrichum gloeosporioides Cg-14] Length = 164 Score = 105 bits (261), Expect = 5e-26 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNSRV 275 GRHKANIAF FLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYN+RV Sbjct: 114 GRHKANIAFNFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNARV 164 >ENH76464.1 integral membrane protein [Colletotrichum orbiculare MAFF 240422] Length = 164 Score = 92.8 bits (229), Expect = 3e-21 Identities = 45/51 (88%), Positives = 46/51 (90%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNSRV 275 GRHKANIAF FLSAIVWLASALIGLFWVRRRTAVAD+R RRRWYNSRV Sbjct: 114 GRHKANIAFAFLSAIVWLASALIGLFWVRRRTAVADSRAPRARRRWYNSRV 164 >KZL65749.1 integral membrane protein [Colletotrichum tofieldiae] OHW93845.1 integral membrane protein [Colletotrichum incanum] Length = 164 Score = 88.6 bits (218), Expect = 2e-19 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNS 281 GR+KANIAF FLSAIVWLASAL+GLFWVRRRTAVAD+RPA RRRWY S Sbjct: 113 GRNKANIAFCFLSAIVWLASALVGLFWVRRRTAVADSRPAHGRRRWYRS 161 >XP_008096328.1 hypothetical protein GLRG_07452 [Colletotrichum graminicola M1.001] EFQ32308.1 hypothetical protein GLRG_07452 [Colletotrichum graminicola M1.001] Length = 165 Score = 87.4 bits (215), Expect = 4e-19 Identities = 43/50 (86%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVH-RRRWYNS 281 GR+KANIAF FLSAIVWLA+ALIGLFWVRRRTAVADNRP H RRRWY S Sbjct: 113 GRNKANIAFCFLSAIVWLAAALIGLFWVRRRTAVADNRPVHHGRRRWYRS 162 >KZL68585.1 integral membrane protein, partial [Colletotrichum incanum] Length = 221 Score = 88.6 bits (218), Expect = 6e-19 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNS 281 GR+KANIAF FLSAIVWLASAL+GLFWVRRRTAVAD+RPA RRRWY S Sbjct: 170 GRNKANIAFCFLSAIVWLASALVGLFWVRRRTAVADSRPAHGRRRWYRS 218 >OHE91483.1 hypothetical protein CORC01_13216 [Colletotrichum orchidophilum] Length = 165 Score = 86.7 bits (213), Expect = 9e-19 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNS 281 GR+KANIAF FLSAIVWLASAL+GLFWVRRR AVAD+RPA RRRWY S Sbjct: 114 GRNKANIAFCFLSAIVWLASALVGLFWVRRRAAVADSRPAHGRRRWYRS 162 >KDN66963.1 hypothetical protein CSUB01_08341 [Colletotrichum sublineola] Length = 164 Score = 85.5 bits (210), Expect = 2e-18 Identities = 40/49 (81%), Positives = 43/49 (87%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNS 281 GR+KANIAF FLSAIVWLASA +GLFWVRRRTAVAD+RP RRRWY S Sbjct: 113 GRNKANIAFCFLSAIVWLASAFVGLFWVRRRTAVADSRPVHGRRRWYRS 161 >KXH51345.1 hypothetical protein CSAL01_12141 [Colletotrichum salicis] Length = 164 Score = 85.1 bits (209), Expect = 3e-18 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNS 281 GR+KANIAF FLSAIVWLASAL+GLFWVRRRTAVAD+RPA RRRWY S Sbjct: 114 GRNKANIAFCFLSAIVWLASALVGLFWVRRRTAVADSRPA-GRRRWYRS 161 >KXH50331.1 hypothetical protein CSIM01_05389 [Colletotrichum simmondsii] KXH62081.1 hypothetical protein CNYM01_10861 [Colletotrichum nymphaeae SA-01] Length = 166 Score = 85.1 bits (209), Expect = 4e-18 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPA-VHRRRWYNS 281 GR+KANIAF FLSAIVWLASAL+GLFWVRRRTAVAD+RPA RRRWY S Sbjct: 114 GRNKANIAFCFLSAIVWLASALVGLFWVRRRTAVADSRPAHTGRRRWYRS 163 >XP_007591476.1 hypothetical protein CFIO01_02327 [Colletotrichum fioriniae PJ7] EXF84791.1 hypothetical protein CFIO01_02327 [Colletotrichum fioriniae PJ7] Length = 166 Score = 85.1 bits (209), Expect = 4e-18 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 1/50 (2%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPA-VHRRRWYNS 281 GR+KANIAF FLSAIVWLASAL+GLFWVRRRTAVAD+RPA RRRWY S Sbjct: 114 GRNKANIAFCFLSAIVWLASALVGLFWVRRRTAVADSRPAHTGRRRWYRS 163 >XP_018155671.1 Integral membrane protein [Colletotrichum higginsianum IMI 349063] CCF40065.1 hypothetical protein CH063_10734 [Colletotrichum higginsianum] OBR07153.1 Integral membrane protein [Colletotrichum higginsianum IMI 349063] Length = 164 Score = 81.3 bits (199), Expect = 1e-16 Identities = 39/49 (79%), Positives = 41/49 (83%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNS 281 GR+KANIAF FLSAIVWLASAL+GLFWVRRR AVAD R RRRWY S Sbjct: 113 GRNKANIAFCFLSAIVWLASALVGLFWVRRRNAVADTRHTHGRRRWYRS 161 >OLN86387.1 hypothetical protein CCHL11_06374 [Colletotrichum chlorophyti] Length = 161 Score = 79.3 bits (194), Expect = 6e-16 Identities = 38/49 (77%), Positives = 40/49 (81%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWYNS 281 GRHKANIAFTFLSAIVWL SAL+G+FWVRRRTA AD RRRWY S Sbjct: 113 GRHKANIAFTFLSAIVWLTSALVGIFWVRRRTATADTH---SRRRWYRS 158 >XP_014545577.1 integral membrane protein, partial [Metarhizium brunneum ARSEF 3297] KID76405.1 integral membrane protein, partial [Metarhizium brunneum ARSEF 3297] Length = 164 Score = 68.9 bits (167), Expect = 6e-12 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWY 287 GR KAN+AF+FLSAI+WLASALIG+FW+R++ A A HRRRWY Sbjct: 113 GRFKANLAFSFLSAILWLASALIGIFWMRKQERRARAETAPHRRRWY 159 >XP_007819098.1 integral membrane protein [Metarhizium robertsii ARSEF 23] EFZ01680.1 integral membrane protein [Metarhizium robertsii ARSEF 23] EXU96091.1 membrane-associating domain protein [Metarhizium robertsii] Length = 164 Score = 68.9 bits (167), Expect = 6e-12 Identities = 31/47 (65%), Positives = 38/47 (80%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWY 287 GR KAN+AF+FLSAI+WLASALIG+FW+R++ A A HRRRWY Sbjct: 113 GRFKANLAFSFLSAILWLASALIGIFWMRKQERRARAETAPHRRRWY 159 >KFG78164.1 integral membrane protein [Metarhizium anisopliae] KID71578.1 integral membrane protein, partial [Metarhizium anisopliae ARSEF 549] KJK84619.1 hypothetical protein H634G_00140 [Metarhizium anisopliae BRIP 53293] KJK91491.1 hypothetical protein H633G_04638 [Metarhizium anisopliae BRIP 53284] Length = 164 Score = 67.4 bits (163), Expect = 2e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWY 287 GR KAN+AF+FLSAI+WLASALIG+FW+R++ A HRRRWY Sbjct: 113 GRFKANLAFSFLSAILWLASALIGIFWMRKQERRVRAETAPHRRRWY 159 >XP_018175495.1 integral membrane protein [Purpureocillium lilacinum] OAQ82867.1 integral membrane protein [Purpureocillium lilacinum] Length = 165 Score = 66.2 bits (160), Expect = 7e-11 Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHR-RRWY-NSRV 275 G+ KA+IAF FLSA++WL SALIGLFWVRRR VA A HR RWY SRV Sbjct: 113 GKFKADIAFAFLSAVLWLVSALIGLFWVRRRERVAARADAYHRHHRWYRRSRV 165 >OAQ74757.1 integral membrane protein [Purpureocillium lilacinum] Length = 165 Score = 66.2 bits (160), Expect = 7e-11 Identities = 35/53 (66%), Positives = 39/53 (73%), Gaps = 2/53 (3%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHR-RRWY-NSRV 275 G+ KA+IAF FLSA++WL SALIGLFWVRRR VA A HR RWY SRV Sbjct: 113 GKFKADIAFAFLSAVLWLVSALIGLFWVRRRERVAARADAYHRHHRWYRRSRV 165 >XP_007810245.1 integral membrane protein [Metarhizium acridum CQMa 102] EFY90147.1 integral membrane protein [Metarhizium acridum CQMa 102] Length = 164 Score = 65.5 bits (158), Expect = 1e-10 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -2 Query: 427 GRHKANIAFTFLSAIVWLASALIGLFWVRRRTAVADNRPAVHRRRWY 287 G+ KA++AF+FLSA++WLASALIG+FW+R+ A A HRRRWY Sbjct: 113 GKFKADLAFSFLSAVLWLASALIGIFWMRKHERRAGAEAAPHRRRWY 159 >KXX74413.1 CASP-like protein UU5 [Madurella mycetomatis] Length = 164 Score = 65.1 bits (157), Expect = 2e-10 Identities = 32/49 (65%), Positives = 37/49 (75%), Gaps = 1/49 (2%) Frame = -2 Query: 418 KANIAFTFLSAIVWLASALIGLFWVRRRT-AVADNRPAVHRRRWYNSRV 275 KA IAF FLSAI WLASA++G++WVRR T VAD HRRRWY SR+ Sbjct: 118 KATIAFAFLSAICWLASAILGIYWVRRHTVTVADGH--YHRRRWYRSRI 164