BLASTX nr result
ID: Magnolia22_contig00022262
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00022262 (904 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007227177.1 hypothetical protein PRUPE_ppa020455mg [Prunus pe... 98 3e-19 XP_004301045.1 PREDICTED: pentatricopeptide repeat-containing pr... 96 2e-18 XP_008222289.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 4e-18 AFG65809.1 hypothetical protein 2_9455_01, partial [Pinus taeda] 88 9e-18 AFG65806.1 hypothetical protein 2_9455_01, partial [Pinus taeda]... 88 9e-18 AFG65804.1 hypothetical protein 2_9455_01, partial [Pinus taeda]... 88 9e-18 AEW08424.1 hypothetical protein 2_9455_01, partial [Pinus radiat... 88 9e-18 XP_010258005.1 PREDICTED: pentatricopeptide repeat-containing pr... 94 1e-17 AFG61376.1 hypothetical protein 0_7614_01, partial [Pinus taeda] 86 2e-17 AEW07637.1 hypothetical protein 0_7614_01, partial [Pinus radiat... 86 2e-17 XP_009353486.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 3e-17 XP_010097931.1 hypothetical protein L484_009366 [Morus notabilis... 92 4e-17 XP_018829220.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 4e-17 AEW08425.1 hypothetical protein 2_9455_01, partial [Pinus lamber... 86 5e-17 XP_015898285.1 PREDICTED: pentatricopeptide repeat-containing pr... 92 5e-17 AFG65812.1 hypothetical protein 2_9455_01, partial [Pinus taeda]... 86 6e-17 ADE76547.1 unknown [Picea sitchensis] 87 1e-16 AFG65800.1 hypothetical protein 2_9455_01, partial [Pinus taeda]... 85 1e-16 JAU31354.1 Pentatricopeptide repeat-containing protein, partial ... 82 3e-16 EEE51585.1 hypothetical protein OsJ_32821 [Oryza sativa Japonica... 83 3e-16 >XP_007227177.1 hypothetical protein PRUPE_ppa020455mg [Prunus persica] ONI29728.1 hypothetical protein PRUPE_1G211300 [Prunus persica] Length = 654 Score = 98.2 bits (243), Expect = 3e-19 Identities = 42/47 (89%), Positives = 44/47 (93%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVCRNCH SAKIIS+MVGREI+LKDPN FHHFKDG CSCGDFW Sbjct: 608 TKNLRVCRNCHDSAKIISQMVGREIILKDPNCFHHFKDGYCSCGDFW 654 >XP_004301045.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 656 Score = 95.9 bits (237), Expect = 2e-18 Identities = 41/47 (87%), Positives = 42/47 (89%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVCRNCH SAK ISKMVGREI+LKDP FHHFKDG CSCGDFW Sbjct: 610 TKNLRVCRNCHASAKAISKMVGREIILKDPKCFHHFKDGYCSCGDFW 656 >XP_008222289.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Prunus mume] Length = 654 Score = 95.1 bits (235), Expect = 4e-18 Identities = 41/47 (87%), Positives = 43/47 (91%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC NCH SAKIIS+MVGREI+LKDPN FHHFKDG CSCGDFW Sbjct: 608 TKNLRVCCNCHDSAKIISQMVGREIILKDPNCFHHFKDGYCSCGDFW 654 >AFG65809.1 hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 88.2 bits (217), Expect = 9e-18 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC +CH + K ISK+VGREI+++D NRFHHFKDGLCSCGD+W Sbjct: 110 TKNLRVCGDCHRATKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >AFG65806.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65807.1 hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 88.2 bits (217), Expect = 9e-18 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC +CH + K ISK+VGREI+++D NRFHHFKDGLCSCGD+W Sbjct: 110 TKNLRVCGDCHRTTKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >AFG65804.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65805.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65814.1 hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 88.2 bits (217), Expect = 9e-18 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC +CH + K ISK+VGREI+++D NRFHHFKDGLCSCGD+W Sbjct: 110 TKNLRVCGDCHRATKFISKVVGREIIMRDANRFHHFKDGLCSCGDYW 156 >AEW08424.1 hypothetical protein 2_9455_01, partial [Pinus radiata] AFG65801.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65803.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65808.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65810.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65811.1 hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 88.2 bits (217), Expect = 9e-18 Identities = 35/47 (74%), Positives = 42/47 (89%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC +CH + K ISK+VGREI+++D NRFHHFKDGLCSCGD+W Sbjct: 110 TKNLRVCGDCHRATKFISKVVGREIIMRDSNRFHHFKDGLCSCGDYW 156 >XP_010258005.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Nelumbo nucifera] XP_010258006.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Nelumbo nucifera] Length = 663 Score = 93.6 bits (231), Expect = 1e-17 Identities = 40/47 (85%), Positives = 43/47 (91%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC NCH SAK+ISK+V REIVLKDPNRFHHFK+G CSCGDFW Sbjct: 617 TKNLRVCHNCHYSAKLISKIVEREIVLKDPNRFHHFKNGYCSCGDFW 663 >AFG61376.1 hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 85.9 bits (211), Expect = 2e-17 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = +2 Query: 5 KNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 KNLRVC +CHT+ K ISK+VGREI+++D NRFHHFK+GLCSCGD+W Sbjct: 65 KNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >AEW07637.1 hypothetical protein 0_7614_01, partial [Pinus radiata] AFG61375.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61377.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61378.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61379.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61380.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61381.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61382.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61383.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61384.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61385.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61386.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61387.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61388.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61389.1 hypothetical protein 0_7614_01, partial [Pinus taeda] AFG61390.1 hypothetical protein 0_7614_01, partial [Pinus taeda] Length = 110 Score = 85.9 bits (211), Expect = 2e-17 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = +2 Query: 5 KNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 KNLRVC +CHT+ K ISK+VGREI+++D NRFHHFK+GLCSCGD+W Sbjct: 65 KNLRVCIDCHTATKFISKIVGREIIVRDANRFHHFKNGLCSCGDYW 110 >XP_009353486.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Pyrus x bretschneideri] Length = 693 Score = 92.4 bits (228), Expect = 3e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVCR CH SAKIIS+MVGREI+LKDPN FHHFKDG C+C DFW Sbjct: 647 TKNLRVCRRCHDSAKIISRMVGREIILKDPNCFHHFKDGYCTCDDFW 693 >XP_010097931.1 hypothetical protein L484_009366 [Morus notabilis] EXB73287.1 hypothetical protein L484_009366 [Morus notabilis] Length = 676 Score = 92.0 bits (227), Expect = 4e-17 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKN RVCR CH SAK IS +VGREI+LKDPNRFHHF+DGLCSCGDFW Sbjct: 630 TKNHRVCRFCHESAKAISNIVGREIILKDPNRFHHFRDGLCSCGDFW 676 >XP_018829220.1 PREDICTED: pentatricopeptide repeat-containing protein At2g01510, mitochondrial-like [Juglans regia] Length = 682 Score = 92.0 bits (227), Expect = 4e-17 Identities = 37/47 (78%), Positives = 44/47 (93%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 +KNLRVCRNCH SAK+ISK+VGREI++KDPN FHHF++G CSCGDFW Sbjct: 636 SKNLRVCRNCHDSAKMISKIVGREIIVKDPNCFHHFREGFCSCGDFW 682 >AEW08425.1 hypothetical protein 2_9455_01, partial [Pinus lambertiana] Length = 156 Score = 86.3 bits (212), Expect = 5e-17 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC +CH + K ISK+VGREI+++D NRFHHFKDG CSCGD+W Sbjct: 110 TKNLRVCGDCHGATKFISKVVGREIIMRDANRFHHFKDGFCSCGDYW 156 >XP_015898285.1 PREDICTED: pentatricopeptide repeat-containing protein DOT4, chloroplastic-like [Ziziphus jujuba] Length = 666 Score = 91.7 bits (226), Expect = 5e-17 Identities = 39/47 (82%), Positives = 41/47 (87%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVCRNCH AKIISK V REI+LKDPNRFHHF+DG CSCGD W Sbjct: 620 TKNLRVCRNCHDCAKIISKFVQREIILKDPNRFHHFQDGFCSCGDCW 666 >AFG65812.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65813.1 hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 85.9 bits (211), Expect = 6e-17 Identities = 35/47 (74%), Positives = 41/47 (87%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC +CH + K ISK+VGREI ++D NRFHHFKDGLCSCGD+W Sbjct: 110 TKNLRVCGDCHRATKFISKVVGREINMRDANRFHHFKDGLCSCGDYW 156 >ADE76547.1 unknown [Picea sitchensis] Length = 210 Score = 86.7 bits (213), Expect = 1e-16 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = +2 Query: 5 KNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 KNLRVC +CHT+ K ISK+ GREIV++D NRFHHFKDGLCSCGD+W Sbjct: 165 KNLRVCVDCHTATKFISKIAGREIVVRDANRFHHFKDGLCSCGDYW 210 >AFG65800.1 hypothetical protein 2_9455_01, partial [Pinus taeda] AFG65802.1 hypothetical protein 2_9455_01, partial [Pinus taeda] Length = 156 Score = 85.1 bits (209), Expect = 1e-16 Identities = 34/47 (72%), Positives = 41/47 (87%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 TKNLRVC +CH + K ISK+VGREI+++D NRFH FKDGLCSCGD+W Sbjct: 110 TKNLRVCGDCHRATKFISKVVGREIIMRDANRFHRFKDGLCSCGDYW 156 >JAU31354.1 Pentatricopeptide repeat-containing protein, partial [Noccaea caerulescens] Length = 77 Score = 81.6 bits (200), Expect = 3e-16 Identities = 34/44 (77%), Positives = 39/44 (88%) Frame = +2 Query: 2 TKNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCG 133 TKNLR C NCH + KIISK+VGREIV++D NRFHHFKDG+CSCG Sbjct: 34 TKNLRACVNCHAATKIISKLVGREIVVRDTNRFHHFKDGVCSCG 77 >EEE51585.1 hypothetical protein OsJ_32821 [Oryza sativa Japonica Group] Length = 127 Score = 83.2 bits (204), Expect = 3e-16 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = +2 Query: 5 KNLRVCRNCHTSAKIISKMVGREIVLKDPNRFHHFKDGLCSCGDFW 142 KNLRVC +CH SAK++S++ GREIV++D RFHHF+DG+CSCGDFW Sbjct: 82 KNLRVCADCHESAKLVSRVYGREIVMRDRTRFHHFRDGVCSCGDFW 127