BLASTX nr result
ID: Magnolia22_contig00022220
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00022220 (1166 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ONK58789.1 uncharacterized protein A4U43_C09F16660 [Asparagus of... 72 8e-11 XP_011097384.1 PREDICTED: ribosomal RNA-processing protein 8 iso... 71 3e-10 AFK48987.1 unknown [Lotus japonicus] 66 4e-10 XP_010108839.1 Ribosomal RNA-processing protein 8 [Morus notabil... 69 2e-09 KDO38976.1 hypothetical protein CISIN_1g0225922mg, partial [Citr... 65 2e-09 KMZ58172.1 Ribosomal RNA-processing protein 8 [Zostera marina] 69 2e-09 XP_010248648.1 PREDICTED: ribosomal RNA-processing protein 8 iso... 68 3e-09 XP_009371761.1 PREDICTED: ribosomal RNA-processing protein 8-lik... 68 3e-09 XP_008341381.1 PREDICTED: ribosomal RNA-processing protein 8 [Ma... 68 3e-09 XP_010248647.1 PREDICTED: ribosomal RNA-processing protein 8 iso... 68 4e-09 KZM90908.1 hypothetical protein DCAR_021727 [Daucus carota subsp... 66 6e-09 XP_004304660.1 PREDICTED: ribosomal RNA-processing protein 8 [Fr... 67 7e-09 CBI34852.3 unnamed protein product, partial [Vitis vinifera] 65 1e-08 XP_017255404.1 PREDICTED: ribosomal RNA-processing protein 8 [Da... 66 1e-08 XP_010932411.1 PREDICTED: ribosomal RNA-processing protein 8 [El... 66 1e-08 ONI19705.1 hypothetical protein PRUPE_3G293000 [Prunus persica] 66 1e-08 XP_008230524.1 PREDICTED: ribosomal RNA-processing protein 8 [Pr... 66 1e-08 CAN65396.1 hypothetical protein VITISV_009442 [Vitis vinifera] 65 1e-08 KNA16042.1 hypothetical protein SOVF_092780 [Spinacia oleracea] 66 2e-08 XP_006446617.1 hypothetical protein CICLE_v10016139mg [Citrus cl... 66 2e-08 >ONK58789.1 uncharacterized protein A4U43_C09F16660 [Asparagus officinalis] Length = 219 Score = 71.6 bits (174), Expect = 8e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DF+NKMFVLFYFKKKE +VK+IEWPELKPC+YKRR Sbjct: 183 DFTNKMFVLFYFKKKEAASKVKNIEWPELKPCIYKRR 219 >XP_011097384.1 PREDICTED: ribosomal RNA-processing protein 8 isoform X1 [Sesamum indicum] Length = 277 Score = 70.9 bits (172), Expect = 3e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFYFKKKE K++ KDIEWPELKPCLYKRR Sbjct: 242 DFSNKMFILFYFKKKE-KQKSKDIEWPELKPCLYKRR 277 >AFK48987.1 unknown [Lotus japonicus] Length = 94 Score = 66.2 bits (160), Expect = 4e-10 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFYF KKE K K+IEWP LKPCLYKRR Sbjct: 58 DFSNKMFILFYFTKKEKKNSKKNIEWPMLKPCLYKRR 94 >XP_010108839.1 Ribosomal RNA-processing protein 8 [Morus notabilis] EXC20354.1 Ribosomal RNA-processing protein 8 [Morus notabilis] Length = 364 Score = 69.3 bits (168), Expect = 2e-09 Identities = 33/39 (84%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGK--KRVKDIEWPELKPCLYKRR 1054 DFSNKMF+L YFKKKE K KR KDIEWPELKPCLYKRR Sbjct: 326 DFSNKMFILLYFKKKEVKDSKRRKDIEWPELKPCLYKRR 364 >KDO38976.1 hypothetical protein CISIN_1g0225922mg, partial [Citrus sinensis] Length = 112 Score = 64.7 bits (156), Expect = 2e-09 Identities = 28/38 (73%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKK-RVKDIEWPELKPCLYKRR 1054 DFSNKMF++FYFKKKE + + K+I+WPELKPCLYKRR Sbjct: 75 DFSNKMFIMFYFKKKEKQNSKSKEIQWPELKPCLYKRR 112 >KMZ58172.1 Ribosomal RNA-processing protein 8 [Zostera marina] Length = 375 Score = 69.3 bits (168), Expect = 2e-09 Identities = 32/39 (82%), Positives = 34/39 (87%), Gaps = 2/39 (5%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKR--VKDIEWPELKPCLYKRR 1054 DFSNKMFVLFYFKKKE R +KDIEWPELKPC+YKRR Sbjct: 337 DFSNKMFVLFYFKKKEKVSRTSIKDIEWPELKPCMYKRR 375 >XP_010248648.1 PREDICTED: ribosomal RNA-processing protein 8 isoform X2 [Nelumbo nucifera] Length = 259 Score = 67.8 bits (164), Expect = 3e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DFSNKMFVLF+FKKK+ K+IEWPELKPC+YKRR Sbjct: 223 DFSNKMFVLFFFKKKKASPETKEIEWPELKPCIYKRR 259 >XP_009371761.1 PREDICTED: ribosomal RNA-processing protein 8-like [Pyrus x bretschneideri] Length = 294 Score = 68.2 bits (165), Expect = 3e-09 Identities = 31/38 (81%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGK-KRVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFYFKKKE + + KDIEWPELKPCLYKRR Sbjct: 257 DFSNKMFILFYFKKKEEQDSKKKDIEWPELKPCLYKRR 294 >XP_008341381.1 PREDICTED: ribosomal RNA-processing protein 8 [Malus domestica] Length = 294 Score = 68.2 bits (165), Expect = 3e-09 Identities = 31/38 (81%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGK-KRVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFYFKKKE + + KDIEWPELKPCLYKRR Sbjct: 257 DFSNKMFILFYFKKKEEQDSKKKDIEWPELKPCLYKRR 294 >XP_010248647.1 PREDICTED: ribosomal RNA-processing protein 8 isoform X1 [Nelumbo nucifera] Length = 286 Score = 67.8 bits (164), Expect = 4e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DFSNKMFVLF+FKKK+ K+IEWPELKPC+YKRR Sbjct: 250 DFSNKMFVLFFFKKKKASPETKEIEWPELKPCIYKRR 286 >KZM90908.1 hypothetical protein DCAR_021727 [Daucus carota subsp. sativus] Length = 219 Score = 66.2 bits (160), Expect = 6e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFY+KKKE K K+I+WP LKPCLYKRR Sbjct: 183 DFSNKMFILFYYKKKEKLKSKKEIKWPSLKPCLYKRR 219 >XP_004304660.1 PREDICTED: ribosomal RNA-processing protein 8 [Fragaria vesca subsp. vesca] Length = 277 Score = 67.0 bits (162), Expect = 7e-09 Identities = 30/38 (78%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKK-RVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFYFKKKE + + KDI+WPELKPCLYKRR Sbjct: 240 DFSNKMFILFYFKKKEEQNSKKKDIDWPELKPCLYKRR 277 >CBI34852.3 unnamed protein product, partial [Vitis vinifera] Length = 220 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKK-RVKDIEWPELKPCLYKRR 1054 DFSNKMF+L YFKKKE + +VK+I+WPELKPCLYKRR Sbjct: 183 DFSNKMFILLYFKKKEKQNSKVKEIDWPELKPCLYKRR 220 >XP_017255404.1 PREDICTED: ribosomal RNA-processing protein 8 [Daucus carota subsp. sativus] Length = 280 Score = 66.2 bits (160), Expect = 1e-08 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFY+KKKE K K+I+WP LKPCLYKRR Sbjct: 244 DFSNKMFILFYYKKKEKLKSKKEIKWPSLKPCLYKRR 280 >XP_010932411.1 PREDICTED: ribosomal RNA-processing protein 8 [Elaeis guineensis] Length = 285 Score = 66.2 bits (160), Expect = 1e-08 Identities = 28/37 (75%), Positives = 33/37 (89%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKRVKDIEWPELKPCLYKRR 1054 DF+NKMF+LFYFKKKE V++IEWPELKPC+YKRR Sbjct: 249 DFTNKMFLLFYFKKKEKISGVRNIEWPELKPCIYKRR 285 >ONI19705.1 hypothetical protein PRUPE_3G293000 [Prunus persica] Length = 291 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKK-RVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFYFKKKE + + K++EWPELKPCLYKRR Sbjct: 254 DFSNKMFILFYFKKKEEQSSKKKEVEWPELKPCLYKRR 291 >XP_008230524.1 PREDICTED: ribosomal RNA-processing protein 8 [Prunus mume] Length = 291 Score = 66.2 bits (160), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKK-RVKDIEWPELKPCLYKRR 1054 DFSNKMF+LFYFKKKE + + K++EWPELKPCLYKRR Sbjct: 254 DFSNKMFILFYFKKKEEQSSKKKEVEWPELKPCLYKRR 291 >CAN65396.1 hypothetical protein VITISV_009442 [Vitis vinifera] Length = 237 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKK-RVKDIEWPELKPCLYKRR 1054 DFSNKMF+L YFKKKE + +VK+I+WPELKPCLYKRR Sbjct: 200 DFSNKMFILLYFKKKEKQNSKVKEIDWPELKPCLYKRR 237 >KNA16042.1 hypothetical protein SOVF_092780 [Spinacia oleracea] Length = 280 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/38 (78%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKKR-VKDIEWPELKPCLYKRR 1054 DFSNKMF+LF+FKKKE + R V +IEWPELKPCLYKRR Sbjct: 243 DFSNKMFILFFFKKKEEQLRDVNEIEWPELKPCLYKRR 280 >XP_006446617.1 hypothetical protein CICLE_v10016139mg [Citrus clementina] ESR59857.1 hypothetical protein CICLE_v10016139mg [Citrus clementina] Length = 290 Score = 65.9 bits (159), Expect = 2e-08 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 1/38 (2%) Frame = -3 Query: 1164 DFSNKMFVLFYFKKKEGKK-RVKDIEWPELKPCLYKRR 1054 DFSNKMF++FYFKKKE + + K+IEWPELKPCLYKRR Sbjct: 253 DFSNKMFIMFYFKKKEKQNSKSKEIEWPELKPCLYKRR 290