BLASTX nr result
ID: Magnolia22_contig00021712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00021712 (304 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016228388.1 hypothetical protein PV10_00630 [Exophiala mesoph... 91 2e-19 CCF47415.1 phthalate transporter, partial [Colletotrichum higgin... 80 1e-16 CRK33515.1 hypothetical protein BN1708_001192 [Verticillium long... 82 3e-16 CRK40448.1 hypothetical protein BN1723_015720 [Verticillium long... 82 3e-16 CRK16616.1 hypothetical protein BN1708_002873 [Verticillium long... 82 3e-16 OHF03689.1 major facilitator superfamily transporter [Colletotri... 82 4e-16 OLN85648.1 putative tartrate transporter 2 [Colletotrichum chlor... 81 1e-15 XP_018161940.1 Major facilitator superfamily transporter [Collet... 80 1e-15 KZL67487.1 major facilitator superfamily transporter [Colletotri... 80 1e-15 KXH37441.1 major facilitator superfamily transporter [Colletotri... 80 2e-15 KXH25366.1 major facilitator superfamily transporter [Colletotri... 80 2e-15 XP_007591950.1 major facilitator superfamily transporter [Collet... 80 2e-15 XP_008089138.1 major facilitator superfamily transporter [Collet... 80 3e-15 ENH86286.1 MFS transporter [Colletotrichum orbiculare MAFF 240422] 80 3e-15 XP_007279567.1 major facilitator superfamily transporter [Collet... 79 6e-15 EQB48189.1 hypothetical protein CGLO_12599 [Colletotrichum gloeo... 79 6e-15 OAA45072.1 MFS transporter [Metarhizium rileyi RCEF 4871] 78 1e-14 KHN98739.1 MFS transporter [Metarhizium album ARSEF 1941] 77 2e-14 XP_003849154.1 hypothetical protein MYCGRDRAFT_76232 [Zymoseptor... 77 3e-14 EWY97052.1 hypothetical protein FOYG_05538 [Fusarium oxysporum F... 77 3e-14 >XP_016228388.1 hypothetical protein PV10_00630 [Exophiala mesophila] KIV96814.1 hypothetical protein PV10_00630 [Exophiala mesophila] Length = 499 Score = 91.3 bits (225), Expect = 2e-19 Identities = 40/48 (83%), Positives = 47/48 (97%) Frame = +2 Query: 161 PGEIVELDKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNARTLN 304 PGE++ELD+++E+RIVRKID HILPWVCV+YLINYLDRVNLGNARTLN Sbjct: 22 PGEVLELDREMEKRIVRKIDWHILPWVCVSYLINYLDRVNLGNARTLN 69 >CCF47415.1 phthalate transporter, partial [Colletotrichum higginsianum] Length = 213 Score = 80.5 bits (197), Expect = 1e-16 Identities = 42/64 (65%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++ERRIVRK DL ILPW+CV YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLADKEMERRIVRKQDLRILPWICVTYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >CRK33515.1 hypothetical protein BN1708_001192 [Verticillium longisporum] Length = 475 Score = 82.4 bits (202), Expect = 3e-16 Identities = 44/64 (68%), Positives = 49/64 (76%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK +ERRIVRK DLHILPWVCV+YL+NYLDRVNLGNA Sbjct: 3 DWKAWWSPAPSLDIPGLETVDLADKAMERRIVRKQDLHILPWVCVSYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >CRK40448.1 hypothetical protein BN1723_015720 [Verticillium longisporum] Length = 489 Score = 82.4 bits (202), Expect = 3e-16 Identities = 44/64 (68%), Positives = 49/64 (76%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK +ERRIVRK DLHILPWVCV+YL+NYLDRVNLGNA Sbjct: 3 DWKAWWSPAPSLDIPGLETVDLADKAMERRIVRKQDLHILPWVCVSYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >CRK16616.1 hypothetical protein BN1708_002873 [Verticillium longisporum] Length = 500 Score = 82.4 bits (202), Expect = 3e-16 Identities = 44/64 (68%), Positives = 49/64 (76%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK +ERRIVRK DLHILPWVCV+YL+NYLDRVNLGNA Sbjct: 3 DWKAWWSPAPSLDIPGLETVDLADKAMERRIVRKQDLHILPWVCVSYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >OHF03689.1 major facilitator superfamily transporter [Colletotrichum orchidophilum] Length = 501 Score = 82.0 bits (201), Expect = 4e-16 Identities = 43/64 (67%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DKD+ERRIVRK DL ILPW+CV YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLADKDMERRIVRKQDLRILPWICVTYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >OLN85648.1 putative tartrate transporter 2 [Colletotrichum chlorophyti] Length = 499 Score = 80.9 bits (198), Expect = 1e-15 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DKD+E+RIVRK DL ILPW+C+ YL+NYLDRVNLGNA Sbjct: 3 DWKALMSPAPSLDVPGLETVDLADKDMEKRIVRKQDLRILPWICITYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >XP_018161940.1 Major facilitator superfamily transporter [Colletotrichum higginsianum IMI 349063] OBR13423.1 Major facilitator superfamily transporter [Colletotrichum higginsianum IMI 349063] Length = 423 Score = 80.5 bits (197), Expect = 1e-15 Identities = 42/64 (65%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++ERRIVRK DL ILPW+CV YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLADKEMERRIVRKQDLRILPWICVTYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >KZL67487.1 major facilitator superfamily transporter [Colletotrichum incanum] OHW91180.1 MFS transporter [Colletotrichum incanum] Length = 501 Score = 80.5 bits (197), Expect = 1e-15 Identities = 42/64 (65%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++ERRIVRK DL ILPW+CV YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLADKEMERRIVRKQDLRILPWICVTYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >KXH37441.1 major facilitator superfamily transporter [Colletotrichum simmondsii] Length = 501 Score = 80.1 bits (196), Expect = 2e-15 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++ERRIVRK DL ILPW+C+ YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLADKEMERRIVRKQDLRILPWICITYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >KXH25366.1 major facilitator superfamily transporter [Colletotrichum salicis] Length = 501 Score = 80.1 bits (196), Expect = 2e-15 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++ERRIVRK DL ILPW+C+ YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLADKEMERRIVRKQDLRILPWICITYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >XP_007591950.1 major facilitator superfamily transporter [Colletotrichum fioriniae PJ7] EXF84442.1 major facilitator superfamily transporter [Colletotrichum fioriniae PJ7] KXH64524.1 major facilitator superfamily transporter [Colletotrichum nymphaeae SA-01] Length = 501 Score = 80.1 bits (196), Expect = 2e-15 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++ERRIVRK DL ILPW+C+ YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLADKEMERRIVRKQDLRILPWICITYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >XP_008089138.1 major facilitator superfamily transporter [Colletotrichum graminicola M1.001] EFQ25118.1 major facilitator superfamily transporter [Colletotrichum graminicola M1.001] Length = 500 Score = 79.7 bits (195), Expect = 3e-15 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++ERRIVRK D+ ILPW+CV YL+NYLDRVNLGNA Sbjct: 3 DWKAMFAPAPSLDVPGLETVDLSDKEMERRIVRKQDIRILPWICVTYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >ENH86286.1 MFS transporter [Colletotrichum orbiculare MAFF 240422] Length = 504 Score = 79.7 bits (195), Expect = 3e-15 Identities = 41/64 (64%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DKD+E+RIVRK DL ILPW+C+ YL+NYLDRVNLGNA Sbjct: 3 DWKAFFSPAPSLDVPGLETVDLADKDMEKRIVRKQDLRILPWICITYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >XP_007279567.1 major facilitator superfamily transporter [Colletotrichum gloeosporioides Nara gc5] ELA31386.1 major facilitator superfamily transporter [Colletotrichum gloeosporioides Nara gc5] Length = 439 Score = 78.6 bits (192), Expect = 6e-15 Identities = 40/64 (62%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++E+RIVRK DL ILPW+C+ YL+NYLDRVNLGNA Sbjct: 3 DWKALFSPAPSLDVPGLETVDLADKEMEKRIVRKQDLRILPWICITYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >EQB48189.1 hypothetical protein CGLO_12599 [Colletotrichum gloeosporioides Cg-14] Length = 499 Score = 78.6 bits (192), Expect = 6e-15 Identities = 40/64 (62%), Positives = 48/64 (75%), Gaps = 2/64 (3%) Frame = +2 Query: 119 DTKVTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNA 292 D K P +PG E V+L DK++E+RIVRK DL ILPW+C+ YL+NYLDRVNLGNA Sbjct: 3 DWKALFSPAPSLDVPGLETVDLADKEMEKRIVRKQDLRILPWICITYLLNYLDRVNLGNA 62 Query: 293 RTLN 304 RTLN Sbjct: 63 RTLN 66 >OAA45072.1 MFS transporter [Metarhizium rileyi RCEF 4871] Length = 497 Score = 77.8 bits (190), Expect = 1e-14 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 2/57 (3%) Frame = +2 Query: 140 PVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNARTLN 304 P+ +PG E+V++ DK +ERRIVRK DL ILPWVC+ YL+NYLDRVNLGNARTLN Sbjct: 10 PMPSLDVPGLELVDISDKAMERRIVRKQDLRILPWVCLTYLLNYLDRVNLGNARTLN 66 >KHN98739.1 MFS transporter [Metarhizium album ARSEF 1941] Length = 498 Score = 77.0 bits (188), Expect = 2e-14 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 2/61 (3%) Frame = +2 Query: 128 VTPLPVEKSTLPG-EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNARTL 301 V+P+P +PG E V++ DK +ERRIVRK DL ILPWVC+ YL+NYLDRVNLGNARTL Sbjct: 8 VSPMP--SPDVPGLESVDISDKAMERRIVRKQDLRILPWVCLTYLLNYLDRVNLGNARTL 65 Query: 302 N 304 N Sbjct: 66 N 66 >XP_003849154.1 hypothetical protein MYCGRDRAFT_76232 [Zymoseptoria tritici IPO323] EGP84130.1 hypothetical protein MYCGRDRAFT_76232 [Zymoseptoria tritici IPO323] Length = 503 Score = 76.6 bits (187), Expect = 3e-14 Identities = 39/61 (63%), Positives = 47/61 (77%), Gaps = 5/61 (8%) Frame = +2 Query: 137 LPVEKST---LPG--EIVELDKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNARTL 301 +P ++ST +PG I DK +ERRIVRK DL ILPW+C+ YL+NYLDRVNLGNARTL Sbjct: 9 VPKDRSTSLPMPGLNTIDITDKAIERRIVRKQDLRILPWICICYLLNYLDRVNLGNARTL 68 Query: 302 N 304 N Sbjct: 69 N 69 >EWY97052.1 hypothetical protein FOYG_05538 [Fusarium oxysporum FOSC 3-a] Length = 504 Score = 76.6 bits (187), Expect = 3e-14 Identities = 36/47 (76%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = +2 Query: 167 EIVEL-DKDVERRIVRKIDLHILPWVCVAYLINYLDRVNLGNARTLN 304 E V+L DK++ERRIVRK DL I+PWVC+ YL+NYLDRVNLGNARTLN Sbjct: 21 ETVDLNDKEMERRIVRKQDLRIMPWVCITYLLNYLDRVNLGNARTLN 67