BLASTX nr result
ID: Magnolia22_contig00019931
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00019931 (598 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OJJ45917.1 hypothetical protein ASPZODRAFT_26514 [Penicilliopsis... 56 9e-06 >OJJ45917.1 hypothetical protein ASPZODRAFT_26514 [Penicilliopsis zonata CBS 506.65] Length = 672 Score = 55.8 bits (133), Expect = 9e-06 Identities = 29/85 (34%), Positives = 50/85 (58%), Gaps = 1/85 (1%) Frame = +3 Query: 132 FTFTPTTDVSVDVLSAKSTYARIKIEPMEAFVDATISSV-RRGTLWKVSIPYVPQAAAVP 308 +T+ + ++ VLSAK+T+A + P+E ++ T+ W+VS+ VP A P Sbjct: 3 YTYAIPSSIAETVLSAKTTHATVSFHPIEIYMTGTLERPDEEHDAWRVSVSNVPNPLAHP 62 Query: 309 LQDHKAVLSLSKGEFGRHLGNIDLG 383 + AVL L++GE G+ LG+++LG Sbjct: 63 --NENAVLHLTQGELGKPLGSVELG 85