BLASTX nr result
ID: Magnolia22_contig00019621
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00019621 (676 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value OJJ49752.1 hypothetical protein ASPZODRAFT_1020383 [Penicilliops... 58 2e-07 KKY27946.1 hypothetical protein UCRPC4_g00790 [Phaeomoniella chl... 58 3e-07 XP_002848600.1 conserved hypothetical protein [Arthroderma otae ... 55 2e-06 OCT51490.1 hypothetical protein CLCR_09298 [Cladophialophora car... 55 3e-06 XP_008729138.1 hypothetical protein G647_06596 [Cladophialophora... 55 3e-06 EGD98279.1 hypothetical protein TESG_05659 [Trichophyton tonsura... 55 3e-06 XP_003174363.1 hypothetical protein MGYG_09052 [Nannizzia gypsea... 55 3e-06 XP_007787511.1 hypothetical protein EPUS_06204 [Endocarpon pusil... 57 7e-06 XP_003231650.1 hypothetical protein TERG_07951 [Trichophyton rub... 54 8e-06 XP_016621935.1 hypothetical protein Z519_03850 [Cladophialophora... 54 8e-06 XP_007747575.1 hypothetical protein A1O5_08804 [Cladophialophora... 54 8e-06 >OJJ49752.1 hypothetical protein ASPZODRAFT_1020383 [Penicilliopsis zonata CBS 506.65] Length = 120 Score = 57.8 bits (138), Expect = 2e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWARN 107 EKEGGA NP+R EER S+ DIRAKRKEFA+W RN Sbjct: 80 EKEGGARNPYRRLEERYSFWDIRAKRKEFADWIRN 114 >KKY27946.1 hypothetical protein UCRPC4_g00790 [Phaeomoniella chlamydospora] Length = 139 Score = 58.2 bits (139), Expect = 3e-07 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 EK GG ANPF+A EERP +DIRAKRKEFA+W R Sbjct: 98 EKAGGHANPFKALEERPGLVDIRAKRKEFADWVR 131 >XP_002848600.1 conserved hypothetical protein [Arthroderma otae CBS 113480] EEQ28715.1 conserved hypothetical protein [Arthroderma otae CBS 113480] Length = 118 Score = 55.1 bits (131), Expect = 2e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 EK+GGA NPFR EER +IDIR KR+EFA+W R Sbjct: 75 EKQGGAENPFRGLEERMGFIDIRTKRREFADWVR 108 >OCT51490.1 hypothetical protein CLCR_09298 [Cladophialophora carrionii] Length = 116 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 E++GG ANPFR EER ++DIRA+R+EFAEWA+ Sbjct: 78 ERDGGGANPFRGLEERVGFMDIRAQRREFAEWAK 111 >XP_008729138.1 hypothetical protein G647_06596 [Cladophialophora carrionii CBS 160.54] ETI22521.1 hypothetical protein G647_06596 [Cladophialophora carrionii CBS 160.54] Length = 116 Score = 54.7 bits (130), Expect = 3e-06 Identities = 22/34 (64%), Positives = 29/34 (85%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 E++GG ANPFR EER ++DIRA+R+EFAEWA+ Sbjct: 78 ERDGGGANPFRGLEERVGFMDIRAQRREFAEWAK 111 >EGD98279.1 hypothetical protein TESG_05659 [Trichophyton tonsurans CBS 112818] EGE03198.1 hypothetical protein TEQG_02236 [Trichophyton equinum CBS 127.97] EZF33893.1 hypothetical protein H101_02552 [Trichophyton interdigitale H6] KDB27669.1 hypothetical protein H109_00554 [Trichophyton interdigitale MR816] Length = 117 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 EK GGA NPFR EER ++DIRAKR+EFA+W R Sbjct: 74 EKRGGAENPFRGLEERMGFLDIRAKRREFADWIR 107 >XP_003174363.1 hypothetical protein MGYG_09052 [Nannizzia gypsea CBS 118893] EFR01533.1 hypothetical protein MGYG_09052 [Nannizzia gypsea CBS 118893] Length = 117 Score = 54.7 bits (130), Expect = 3e-06 Identities = 23/34 (67%), Positives = 27/34 (79%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 EK GGA NPFR EER ++DIRAKR+EFA+W R Sbjct: 74 EKRGGAENPFRGLEERMGFLDIRAKRREFADWIR 107 >XP_007787511.1 hypothetical protein EPUS_06204 [Endocarpon pusillum Z07020] ERF75164.1 hypothetical protein EPUS_06204 [Endocarpon pusillum Z07020] Length = 2266 Score = 57.0 bits (136), Expect = 7e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEW 98 EKEGGA NPFR EER ++DIRAKRKEFA+W Sbjct: 83 EKEGGARNPFRGLEERAGFVDIRAKRKEFADW 114 >XP_003231650.1 hypothetical protein TERG_07951 [Trichophyton rubrum CBS 118892] EGD91731.1 hypothetical protein TERG_07951 [Trichophyton rubrum CBS 118892] EZF27137.1 hypothetical protein H100_00842 [Trichophyton rubrum MR850] EZF46126.1 hypothetical protein H102_00834 [Trichophyton rubrum CBS 100081] EZF56742.1 hypothetical protein H103_00842 [Trichophyton rubrum CBS 288.86] EZF67383.1 hypothetical protein H104_00826 [Trichophyton rubrum CBS 289.86] EZF78235.1 hypothetical protein H105_00838 [Trichophyton soudanense CBS 452.61] EZF88707.1 hypothetical protein H110_00842 [Trichophyton rubrum MR1448] EZF99539.1 hypothetical protein H113_00843 [Trichophyton rubrum MR1459] EZG10588.1 hypothetical protein H106_00637 [Trichophyton rubrum CBS 735.88] EZG21042.1 hypothetical protein H107_00892 [Trichophyton rubrum CBS 202.88] KDB37927.1 hypothetical protein H112_00844 [Trichophyton rubrum D6] KMQ44416.1 Magnesium transporter [Trichophyton rubrum] Length = 117 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/34 (64%), Positives = 27/34 (79%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 EK GGA NPF+ EER ++DIRAKR+EFA+W R Sbjct: 74 EKRGGAENPFKGLEERMGFLDIRAKRREFADWIR 107 >XP_016621935.1 hypothetical protein Z519_03850 [Cladophialophora bantiana CBS 173.52] KIW95266.1 hypothetical protein Z519_03850 [Cladophialophora bantiana CBS 173.52] Length = 119 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 E+EGG ANPFR EER ++DIRA+R+ FAEWA+ Sbjct: 78 EREGGGANPFRGLEERVGFMDIRAQRRAFAEWAK 111 >XP_007747575.1 hypothetical protein A1O5_08804 [Cladophialophora psammophila CBS 110553] EXJ68189.1 hypothetical protein A1O5_08804 [Cladophialophora psammophila CBS 110553] Length = 119 Score = 53.5 bits (127), Expect = 8e-06 Identities = 22/34 (64%), Positives = 28/34 (82%) Frame = +3 Query: 3 EKEGGAANPFRAFEERPSYIDIRAKRKEFAEWAR 104 E+EGG ANPFR EER ++DIRA+R+ FAEWA+ Sbjct: 78 EREGGGANPFRGLEERVGFMDIRAQRRAFAEWAK 111