BLASTX nr result
ID: Magnolia22_contig00019310
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00019310 (377 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010099953.1 UDP-glycosyltransferase 75D1 [Morus notabilis] EX... 54 9e-06 >XP_010099953.1 UDP-glycosyltransferase 75D1 [Morus notabilis] EXB80936.1 UDP-glycosyltransferase 75D1 [Morus notabilis] Length = 493 Score = 53.5 bits (127), Expect = 9e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = -3 Query: 375 LRWRELAREAISEGGSSDRNVRTFVAEMTGEG 280 +RWR+LAREA EGGSSD+N++ FVAEM GEG Sbjct: 454 VRWRDLAREAAKEGGSSDKNLKAFVAEMIGEG 485