BLASTX nr result
ID: Magnolia22_contig00018187
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00018187 (371 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KJB68351.1 hypothetical protein B456_010G240500 [Gossypium raimo... 76 2e-15 OMO65460.1 hypothetical protein COLO4_31211 [Corchorus olitorius] 74 6e-15 KDO38009.1 hypothetical protein CISIN_1g041913mg [Citrus sinensis] 72 3e-14 XP_006449561.1 hypothetical protein CICLE_v10018381mg [Citrus cl... 72 3e-14 ERN13138.1 hypothetical protein AMTR_s00040p00186240 [Amborella ... 72 5e-14 KDP21149.1 hypothetical protein JCGZ_21620 [Jatropha curcas] 71 1e-13 EOY27907.1 Uncharacterized protein TCM_029626 [Theobroma cacao] 70 2e-13 ONM20351.1 hypothetical protein ZEAMMB73_Zm00001d005109 [Zea mays] 69 4e-13 NP_001145116.1 uncharacterized protein LOC100278336 precursor [Z... 69 4e-13 XP_006420487.1 hypothetical protein CICLE_v10006937mg [Citrus cl... 69 5e-13 XP_004969829.1 PREDICTED: uncharacterized protein LOC101757588 [... 69 5e-13 EAY75703.1 hypothetical protein OsI_03609 [Oryza sativa Indica G... 69 6e-13 BAB21163.1 unknown protein [Oryza sativa Japonica Group] BAB6351... 69 6e-13 XP_020098788.1 uncharacterized protein LOC109717418 [Ananas como... 69 7e-13 NP_001142834.1 uncharacterized protein LOC100275224 precursor [Z... 69 7e-13 OAY78739.1 hypothetical protein ACMD2_02215 [Ananas comosus] 69 9e-13 XP_017435854.1 PREDICTED: uncharacterized protein LOC108342575 [... 69 9e-13 XP_014518158.1 PREDICTED: uncharacterized protein LOC106775529 [... 69 9e-13 XP_006384074.1 hypothetical protein POPTR_0004s06130g [Populus t... 69 1e-12 OEL18996.1 hypothetical protein BAE44_0019986 [Dichanthelium oli... 69 1e-12 >KJB68351.1 hypothetical protein B456_010G240500 [Gossypium raimondii] Length = 110 Score = 75.9 bits (185), Expect = 2e-15 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RS+CL++ KCRWCRSEA+DDMCF +EAWRLPQQVF CN Sbjct: 72 RSQCLQNPKCRWCRSEALDDMCFKKAEAWRLPQQVFLCN 110 >OMO65460.1 hypothetical protein COLO4_31211 [Corchorus olitorius] Length = 99 Score = 74.3 bits (181), Expect = 6e-15 Identities = 30/39 (76%), Positives = 35/39 (89%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RS+CL++ KCRWCRSEA+DDMCF SEAWRLPQQVF C+ Sbjct: 61 RSQCLQNPKCRWCRSEALDDMCFIKSEAWRLPQQVFLCD 99 >KDO38009.1 hypothetical protein CISIN_1g041913mg [Citrus sinensis] Length = 95 Score = 72.4 bits (176), Expect = 3e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RSEC ++ KC+WCRSEA+DDMCFS SEAWRLP QVF C+ Sbjct: 56 RSECSQNPKCKWCRSEALDDMCFSESEAWRLPHQVFICD 94 >XP_006449561.1 hypothetical protein CICLE_v10018381mg [Citrus clementina] ESR62801.1 hypothetical protein CICLE_v10018381mg [Citrus clementina] KDO77952.1 hypothetical protein CISIN_1g034420mg [Citrus sinensis] Length = 95 Score = 72.4 bits (176), Expect = 3e-14 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RSEC + KC+WCRSEA+DDMCFS SEAWRLP QVF+C+ Sbjct: 56 RSECSLNPKCKWCRSEALDDMCFSESEAWRLPHQVFTCD 94 >ERN13138.1 hypothetical protein AMTR_s00040p00186240 [Amborella trichopoda] Length = 119 Score = 72.4 bits (176), Expect = 5e-14 Identities = 27/38 (71%), Positives = 35/38 (92%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSC 256 +++CL+S KCRWCR E IDDMCFS++EAWRLP+QVF+C Sbjct: 26 KNDCLKSLKCRWCRGEGIDDMCFSSNEAWRLPKQVFTC 63 >KDP21149.1 hypothetical protein JCGZ_21620 [Jatropha curcas] Length = 101 Score = 70.9 bits (172), Expect = 1e-13 Identities = 28/39 (71%), Positives = 34/39 (87%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RS+C ++ KCRWC+SEA+DDMCFS EAWRLPQQVF C+ Sbjct: 63 RSQCSQNPKCRWCKSEALDDMCFSKIEAWRLPQQVFVCD 101 >EOY27907.1 Uncharacterized protein TCM_029626 [Theobroma cacao] Length = 107 Score = 70.5 bits (171), Expect = 2e-13 Identities = 27/39 (69%), Positives = 35/39 (89%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RS+CL++ KCRWC SEA+D++CFS +EAWRLPQQVF C+ Sbjct: 69 RSQCLQNPKCRWCHSEALDNLCFSKAEAWRLPQQVFLCD 107 >ONM20351.1 hypothetical protein ZEAMMB73_Zm00001d005109 [Zea mays] Length = 90 Score = 69.3 bits (168), Expect = 4e-13 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R +C S CRWCRSEA+DDMCF A EAWRLP+QVFSC+ Sbjct: 41 RGQCAASGGCRWCRSEALDDMCFEAIEAWRLPRQVFSCD 79 >NP_001145116.1 uncharacterized protein LOC100278336 precursor [Zea mays] ACG45219.1 hypothetical protein [Zea mays] Length = 90 Score = 69.3 bits (168), Expect = 4e-13 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R +C S CRWCRSEA+DDMCF A EAWRLP+QVFSC+ Sbjct: 41 RGQCAASGGCRWCRSEALDDMCFEAIEAWRLPRQVFSCD 79 >XP_006420487.1 hypothetical protein CICLE_v10006937mg [Citrus clementina] ESR33727.1 hypothetical protein CICLE_v10006937mg [Citrus clementina] KDO43659.1 hypothetical protein CISIN_1g034409mg [Citrus sinensis] Length = 95 Score = 69.3 bits (168), Expect = 5e-13 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RSECL++ KC+ CRSEA+DDMCFS SEAWRLP QVF C+ Sbjct: 56 RSECLQNPKCKRCRSEALDDMCFSKSEAWRLPHQVFICD 94 >XP_004969829.1 PREDICTED: uncharacterized protein LOC101757588 [Setaria italica] KQL06822.1 hypothetical protein SETIT_003464mg [Setaria italica] Length = 100 Score = 69.3 bits (168), Expect = 5e-13 Identities = 28/39 (71%), Positives = 31/39 (79%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R EC CRWCRSEA+DDMCF A+EAWRLP QVFSC+ Sbjct: 52 RGECAARGGCRWCRSEALDDMCFGATEAWRLPDQVFSCD 90 >EAY75703.1 hypothetical protein OsI_03609 [Oryza sativa Indica Group] Length = 101 Score = 69.3 bits (168), Expect = 6e-13 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 3/42 (7%) Frame = -3 Query: 369 RSECLRS---TKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R EC+ S ++CRWCRSEA+DDMCF A+EAWRLP QVFSC+ Sbjct: 49 RGECVASGGGSRCRWCRSEALDDMCFGAAEAWRLPNQVFSCD 90 >BAB21163.1 unknown protein [Oryza sativa Japonica Group] BAB63514.1 unknown protein [Oryza sativa Japonica Group] EEE55332.1 hypothetical protein OsJ_03338 [Oryza sativa Japonica Group] Length = 101 Score = 69.3 bits (168), Expect = 6e-13 Identities = 29/42 (69%), Positives = 35/42 (83%), Gaps = 3/42 (7%) Frame = -3 Query: 369 RSECLRS---TKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R EC+ S ++CRWCRSEA+DDMCF A+EAWRLP QVFSC+ Sbjct: 49 RGECVASGGGSRCRWCRSEALDDMCFGAAEAWRLPNQVFSCD 90 >XP_020098788.1 uncharacterized protein LOC109717418 [Ananas comosus] Length = 110 Score = 69.3 bits (168), Expect = 7e-13 Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 369 RSECLRSTK-CRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R EC RS + CRWCRS+AIDDMCF ++EAWRLP QVFSC+ Sbjct: 63 REECARSPRRCRWCRSDAIDDMCFGSAEAWRLPHQVFSCD 102 >NP_001142834.1 uncharacterized protein LOC100275224 precursor [Zea mays] XP_008669965.1 PREDICTED: uncharacterized protein LOC103647174 [Zea mays] ACG27013.1 hypothetical protein [Zea mays] Length = 112 Score = 69.3 bits (168), Expect = 7e-13 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R +C S CRWCRSEA+DDMCF A EAWRLP+QVFSC+ Sbjct: 63 RGQCAASGGCRWCRSEALDDMCFEAIEAWRLPRQVFSCD 101 >OAY78739.1 hypothetical protein ACMD2_02215 [Ananas comosus] Length = 121 Score = 69.3 bits (168), Expect = 9e-13 Identities = 29/40 (72%), Positives = 34/40 (85%), Gaps = 1/40 (2%) Frame = -3 Query: 369 RSECLRSTK-CRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R EC RS + CRWCRS+AIDDMCF ++EAWRLP QVFSC+ Sbjct: 74 REECARSPRRCRWCRSDAIDDMCFGSAEAWRLPHQVFSCD 113 >XP_017435854.1 PREDICTED: uncharacterized protein LOC108342575 [Vigna angularis] KOM53641.1 hypothetical protein LR48_Vigan09g230000 [Vigna angularis] BAT87236.1 hypothetical protein VIGAN_05058400 [Vigna angularis var. angularis] Length = 107 Score = 68.9 bits (167), Expect = 9e-13 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSC 256 +S+C R++KC WC SE +DDMCFS SEAWRLPQQV+SC Sbjct: 66 QSQCSRNSKCSWCTSEDLDDMCFSKSEAWRLPQQVYSC 103 >XP_014518158.1 PREDICTED: uncharacterized protein LOC106775529 [Vigna radiata var. radiata] Length = 108 Score = 68.9 bits (167), Expect = 9e-13 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSC 256 +S+C R++KC WC SE +DDMCFS SEAWRLPQQV+SC Sbjct: 67 QSQCSRNSKCSWCTSEDLDDMCFSKSEAWRLPQQVYSC 104 >XP_006384074.1 hypothetical protein POPTR_0004s06130g [Populus trichocarpa] ERP61871.1 hypothetical protein POPTR_0004s06130g [Populus trichocarpa] Length = 98 Score = 68.6 bits (166), Expect = 1e-12 Identities = 26/39 (66%), Positives = 32/39 (82%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 RS+C + C+WC+SE +DDMCFS +EAWRLPQQVF CN Sbjct: 60 RSQCSHNPNCKWCKSEVLDDMCFSNAEAWRLPQQVFLCN 98 >OEL18996.1 hypothetical protein BAE44_0019986 [Dichanthelium oligosanthes] Length = 102 Score = 68.6 bits (166), Expect = 1e-12 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -3 Query: 369 RSECLRSTKCRWCRSEAIDDMCFSASEAWRLPQQVFSCN 253 R EC CRWCRSEA++DMCF A+EAWRLP QVFSC+ Sbjct: 54 RGECAARAGCRWCRSEALEDMCFGATEAWRLPSQVFSCD 92