BLASTX nr result
ID: Magnolia22_contig00017681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00017681 (784 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_016299945.1 PREDICTED: GATA zinc finger domain-containing pro... 58 6e-06 >XP_016299945.1 PREDICTED: GATA zinc finger domain-containing protein 14-like, partial [Sinocyclocheilus anshuiensis] Length = 522 Score = 57.8 bits (138), Expect = 6e-06 Identities = 36/114 (31%), Positives = 50/114 (43%), Gaps = 11/114 (9%) Frame = -1 Query: 640 SGWSELVQHPVHA-NHGLQHCLQHRVLDRYGHCHRVQDRDQDQHPGRDRDSSCRHQDYHS 464 S +L+Q ++A L H H +R+G+ H + DQD H ++ H D+H Sbjct: 266 SSLRDLLQRKINALEEQLHHHYGHHD-NRHGYGHHEDNHDQDDHHNNHHNN--HHDDHHD 322 Query: 463 GRDRHSSPSHQDHHASRDR-HTSSSHQDHYSGRDCDTAASHQ---------HHD 332 D H + H DHH+S R H H D YS D +HQ HHD Sbjct: 323 NHDSHQANHHDDHHSSHHRNHHYGHHYDRYSDHHDDHHGNHQDNHQSGHDDHHD 376