BLASTX nr result
ID: Magnolia22_contig00017476
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00017476 (728 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KIV86477.1 hypothetical protein PV11_02088 [Exophiala sideris] 55 1e-06 >KIV86477.1 hypothetical protein PV11_02088 [Exophiala sideris] Length = 81 Score = 55.1 bits (131), Expect = 1e-06 Identities = 27/41 (65%), Positives = 33/41 (80%) Frame = -3 Query: 558 SSPVEFLSSPADAEFDYVSDPTQAMSSYAHMMHSHTKQQME 436 SS VE+L++PA FD+ +DP AMSSYA MMHSHT+QQME Sbjct: 3 SSQVEYLTTPAQP-FDFDADPMTAMSSYARMMHSHTQQQME 42