BLASTX nr result
ID: Magnolia22_contig00017397
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00017397 (562 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AGC78947.1 hypothetical protein (mitochondrion) [Vicia faba] 86 9e-19 YP_007516876.1 hypothetical protein GlmaxMp27 (mitochondrion) [G... 83 2e-17 >AGC78947.1 hypothetical protein (mitochondrion) [Vicia faba] Length = 101 Score = 86.3 bits (212), Expect = 9e-19 Identities = 42/47 (89%), Positives = 45/47 (95%) Frame = -2 Query: 435 SLPTPLVTTERRSQERKEGLEPSTSALARLCSTIKLFPPAPVVAKHY 295 ++PT LVTT+RRSQERKEGLEPSTSALARLCSTIKLFPPA VVAKHY Sbjct: 55 AMPTLLVTTKRRSQERKEGLEPSTSALARLCSTIKLFPPATVVAKHY 101 >YP_007516876.1 hypothetical protein GlmaxMp27 (mitochondrion) [Glycine max] AFR34345.1 hypothetical protein GlmaxMp27 (mitochondrion) [Glycine max] Length = 104 Score = 82.8 bits (203), Expect = 2e-17 Identities = 37/41 (90%), Positives = 39/41 (95%) Frame = -3 Query: 434 RCLLHS*PLNDEARSGRRDLNPQPQPWQGYALPLSYFRQLR 312 RCLL+S PLNDEA+SGRRDLNPQPQPWQGYALPLSYFRQ R Sbjct: 64 RCLLYSLPLNDEAKSGRRDLNPQPQPWQGYALPLSYFRQQR 104