BLASTX nr result
ID: Magnolia22_contig00016712
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00016712 (578 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CCT65955.1 probable RPL39-60S large subunit ribosomal protein L3... 111 1e-28 XP_001542836.1 60S ribosomal protein L39 [Histoplasma capsulatum... 109 3e-28 KEY67153.1 hypothetical protein S7711_03013 [Stachybotrys charta... 108 4e-28 XP_008088900.1 ribosomal L39 protein [Colletotrichum graminicola... 108 4e-28 OLN81572.1 60S ribosomal protein L39 [Colletotrichum chlorophyti] 108 5e-28 XP_003850033.1 60S ribosomal protein L39 [Zymoseptoria tritici I... 108 5e-28 EPS27305.1 hypothetical protein PDE_02248 [Penicillium oxalicum ... 108 8e-28 XP_003189071.1 60S ribosomal protein L39 [Aspergillus oryzae RIB... 108 8e-28 XP_003051759.1 60S ribosomal protein L39 [Nectria haematococca m... 108 8e-28 XP_007675548.1 hypothetical protein BAUCODRAFT_147112 [Baudoinia... 107 1e-27 CCF37051.1 60S ribosomal protein L39 [Colletotrichum higginsianum] 107 1e-27 XP_013947078.1 hypothetical protein TRIATDRAFT_254996 [Trichoder... 107 1e-27 KXH27559.1 hypothetical protein CSIM01_13165 [Colletotrichum sim... 107 1e-27 XP_001908102.1 hypothetical protein [Podospora anserina S mat+] ... 107 2e-27 XP_018074354.1 ribosomal protein L39e [Phialocephala scopiformis... 107 2e-27 XP_003003166.1 60S ribosomal protein L39 [Verticillium alfalfae ... 107 2e-27 XP_016760179.1 ribosomal protein L39e [Sphaerulina musiva SO2202... 107 2e-27 KXT01435.1 hypothetical protein AC578_9547, partial [Mycosphaere... 107 2e-27 XP_002848813.1 hypothetical protein MCYG_01747 [Arthroderma otae... 107 3e-27 KXH37219.1 hypothetical protein CNYM01_09084 [Colletotrichum nym... 106 4e-27 >CCT65955.1 probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi IMI 58289] CVL13757.1 probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium proliferatum] CZR39811.1 probable RPL39-60S large subunit ribosomal protein L39.e [Fusarium proliferatum ET1] Length = 93 Score = 111 bits (277), Expect = 1e-28 Identities = 50/60 (83%), Positives = 56/60 (93%) Frame = +1 Query: 49 TKPTLVSIIMPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 T T+ ++ MPSHKSFRTKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 34 TDSTINAVKMPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 93 >XP_001542836.1 60S ribosomal protein L39 [Histoplasma capsulatum NAm1] XP_003230906.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 118892] XP_003712476.1 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] XP_007599880.1 hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] XP_008022948.1 hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] XP_009219929.1 60S ribosomal protein L39 [Gaeumannomyces tritici R3-111a-1] EDN06404.1 ribosomal protein L39 [Histoplasma capsulatum NAm1] CBF86564.1 TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4] EHA52669.1 60S ribosomal protein L39 [Magnaporthe oryzae 70-15] EJT78784.1 60S ribosomal protein L39 [Gaeumannomyces tritici R3-111a-1] ELQ44608.1 hypothetical protein OOU_Y34scaffold00071g24 [Magnaporthe oryzae Y34] ELQ67556.1 hypothetical protein OOW_P131scaffold00314g129 [Magnaporthe oryzae P131] EOA89386.1 hypothetical protein SETTUDRAFT_46231 [Setosphaeria turcica Et28A] ERS99941.1 60S ribosomal protein L39 [Sporothrix schenckii ATCC 58251] EXF76478.1 hypothetical protein CFIO01_13564 [Colletotrichum fioriniae PJ7] EZF28033.1 60S ribosomal protein L39 [Trichophyton rubrum MR850] EZF47097.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 100081] EZF57748.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 288.86] EZF68319.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 289.86] EZF79023.1 60S ribosomal protein L39 [Trichophyton soudanense CBS 452.61] EZF89637.1 60S ribosomal protein L39 [Trichophyton rubrum MR1448] EZG00476.1 60S ribosomal protein L39 [Trichophyton rubrum MR1459] EZG05683.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 735.88] EZG22078.1 60S ribosomal protein L39 [Trichophyton rubrum CBS 202.88] KDB38828.1 60S ribosomal protein L39 [Trichophyton rubrum D6] KLU81216.1 60S ribosomal protein L39 [Magnaporthiopsis poae ATCC 64411] CEL09978.1 Putative 60S ribosomal protein L39 [Aspergillus calidoustus] OHE95651.1 hypothetical protein CORC01_09083 [Colletotrichum orchidophilum] GAW11006.1 hypothetical protein ANO14919_003450 [fungal sp. No.14919] Length = 51 Score = 109 bits (272), Expect = 3e-28 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >KEY67153.1 hypothetical protein S7711_03013 [Stachybotrys chartarum IBT 7711] KFA46797.1 hypothetical protein S40293_06785 [Stachybotrys chartarum IBT 40293] KFA75011.1 hypothetical protein S40288_02227 [Stachybotrys chartarum IBT 40288] Length = 51 Score = 108 bits (271), Expect = 4e-28 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_008088900.1 ribosomal L39 protein [Colletotrichum graminicola M1.001] EFQ24880.1 ribosomal L39 protein [Colletotrichum graminicola M1.001] Length = 51 Score = 108 bits (271), Expect = 4e-28 Identities = 50/51 (98%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRK+KLGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKSKLGI 51 >OLN81572.1 60S ribosomal protein L39 [Colletotrichum chlorophyti] Length = 51 Score = 108 bits (270), Expect = 5e-28 Identities = 50/51 (98%), Positives = 50/51 (98%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT LGI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTSLGI 51 >XP_003850033.1 60S ribosomal protein L39 [Zymoseptoria tritici IPO323] XP_007781320.1 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] XP_018036096.1 ribosomal protein L39e [Paraphaeosphaeria sporulosa] EGP85009.1 hypothetical protein MYCGRDRAFT_105463 [Zymoseptoria tritici IPO323] EON66003.1 60S ribosomal protein L39 [Coniosporium apollinis CBS 100218] KIN06246.1 hypothetical protein OIDMADRAFT_38580 [Oidiodendron maius Zn] GAM86723.1 hypothetical protein ANO11243_047420 [fungal sp. No.11243] KJX99510.1 60S ribosomal protein L39 [Zymoseptoria brevis] KXL50793.1 hypothetical protein FE78DRAFT_158233 [Acidomyces richmondensis] KYG48472.1 hypothetical protein M433DRAFT_102650 [Acidomyces richmondensis BFW] OAG05731.1 ribosomal protein L39e [Paraphaeosphaeria sporulosa] Length = 51 Score = 108 bits (270), Expect = 5e-28 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >EPS27305.1 hypothetical protein PDE_02248 [Penicillium oxalicum 114-2] Length = 51 Score = 108 bits (269), Expect = 8e-28 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHK+FRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_003189071.1 60S ribosomal protein L39 [Aspergillus oryzae RIB40] KOC07663.1 60S ribosomal protein [Aspergillus flavus AF70] Length = 51 Score = 108 bits (269), Expect = 8e-28 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQ+QNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 1 MPSHKSFRTKQKLAKAQRQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >XP_003051759.1 60S ribosomal protein L39 [Nectria haematococca mpVI 77-13-4] XP_009263131.1 hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] XP_011326588.1 hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] XP_018754742.1 60S ribosomal protein L39 [Fusarium verticillioides 7600] EEU46046.1 predicted protein [Nectria haematococca mpVI 77-13-4] EGU71968.1 hypothetical protein FOXB_17529 [Fusarium oxysporum Fo5176] EKJ67928.1 hypothetical protein FPSE_11739 [Fusarium pseudograminearum CS3096] ESU13081.1 hypothetical protein FGSG_06921 [Fusarium graminearum PH-1] EWG48551.1 60S ribosomal protein L39 [Fusarium verticillioides 7600] EWY98599.1 60S ribosomal protein L39 [Fusarium oxysporum FOSC 3-a] EWZ44675.1 60S ribosomal protein L39 [Fusarium oxysporum Fo47] EWZ98448.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. lycopersici MN25] EXA49958.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. pisi HDV247] EXK42041.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. melonis 26406] EXL00613.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. raphani 54005] EXL62002.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] EXL86129.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. conglutinans race 2 54008] EXL95148.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] EXM36611.1 60S ribosomal protein L39 [Fusarium oxysporum f. sp. vasinfectum 25433] EYB23707.1 hypothetical protein FG05_06921 [Fusarium graminearum] KLO90055.1 putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] KLP09859.1 putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] KLP19369.1 putative RPL39-60S large subunit ribosomal protein L39.e [Fusarium fujikuroi] SCB65143.1 unnamed protein product [Fusarium graminearum] Length = 51 Score = 108 bits (269), Expect = 8e-28 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >XP_007675548.1 hypothetical protein BAUCODRAFT_147112 [Baudoinia panamericana UAMH 10762] EMC96913.1 hypothetical protein BAUCODRAFT_147112 [Baudoinia panamericana UAMH 10762] Length = 51 Score = 107 bits (268), Expect = 1e-27 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT++G+ Sbjct: 1 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGL 51 >CCF37051.1 60S ribosomal protein L39 [Colletotrichum higginsianum] Length = 51 Score = 107 bits (268), Expect = 1e-27 Identities = 49/51 (96%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHK+FRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRK+KLGI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKSKLGI 51 >XP_013947078.1 hypothetical protein TRIATDRAFT_254996 [Trichoderma atroviride IMI 206040] EHK48913.1 hypothetical protein TRIATDRAFT_254996 [Trichoderma atroviride IMI 206040] Length = 51 Score = 107 bits (268), Expect = 1e-27 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHK+FRTKQKLAKAQKQNRP+PQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPVPQWIRLRTGNTIRYNAKRRHWRKTRLGI 51 >KXH27559.1 hypothetical protein CSIM01_13165 [Colletotrichum simmondsii] Length = 58 Score = 107 bits (268), Expect = 1e-27 Identities = 49/55 (89%), Positives = 53/55 (96%) Frame = +1 Query: 64 VSIIMPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 +S+ + SHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 4 ISLAIQSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 58 >XP_001908102.1 hypothetical protein [Podospora anserina S mat+] CAP68775.1 unnamed protein product [Podospora anserina S mat+] CDP32245.1 Putative cytosolic 60S ribosomal protein Rpl39 [Podospora anserina S mat+] Length = 51 Score = 107 bits (267), Expect = 2e-27 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHK+FRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LG+ Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGL 51 >XP_018074354.1 ribosomal protein L39e [Phialocephala scopiformis] KUJ19999.1 ribosomal protein L39e [Phialocephala scopiformis] OCK76137.1 ribosomal protein L39e [Lepidopterella palustris CBS 459.81] OCK98105.1 ribosomal protein L39e [Cenococcum geophilum 1.58] CZR59092.1 probable RPL39-60S large subunit ribosomal protein L39.e [Phialocephala subalpina] Length = 51 Score = 107 bits (267), Expect = 2e-27 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTKQKLA+AQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 1 MPSHKSFRTKQKLARAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >XP_003003166.1 60S ribosomal protein L39 [Verticillium alfalfae VaMs.102] XP_009653481.1 60S ribosomal protein L39 [Verticillium dahliae VdLs.17] EEY20618.1 60S ribosomal protein L39 [Verticillium alfalfae VaMs.102] EGY14625.1 60S ribosomal protein L39 [Verticillium dahliae VdLs.17] CRK30714.1 hypothetical protein BN1708_015843 [Verticillium longisporum] Length = 51 Score = 107 bits (267), Expect = 2e-27 Identities = 49/51 (96%), Positives = 50/51 (98%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHKSFRTK KLAKAQKQNRPIPQW+RLRTGNTIRYNAKRRHWRKTKLGI Sbjct: 1 MPSHKSFRTKVKLAKAQKQNRPIPQWVRLRTGNTIRYNAKRRHWRKTKLGI 51 >XP_016760179.1 ribosomal protein L39e [Sphaerulina musiva SO2202] EMF12058.1 ribosomal protein L39e [Sphaerulina musiva SO2202] Length = 51 Score = 107 bits (267), Expect = 2e-27 Identities = 48/51 (94%), Positives = 51/51 (100%) Frame = +1 Query: 76 MPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 MPSHK+FRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 1 MPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 51 >KXT01435.1 hypothetical protein AC578_9547, partial [Mycosphaerella eumusae] Length = 81 Score = 107 bits (268), Expect = 2e-27 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = +1 Query: 67 SIIMPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 ++ MPSHK+FRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT++GI Sbjct: 28 TVNMPSHKTFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRIGI 81 >XP_002848813.1 hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] EEQ28928.1 hypothetical protein MCYG_01747 [Arthroderma otae CBS 113480] Length = 94 Score = 107 bits (268), Expect = 3e-27 Identities = 50/54 (92%), Positives = 52/54 (96%) Frame = +1 Query: 67 SIIMPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 S+ MPS KSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 41 SVKMPSQKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 94 >KXH37219.1 hypothetical protein CNYM01_09084 [Colletotrichum nymphaeae SA-01] Length = 58 Score = 106 bits (265), Expect = 4e-27 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = +1 Query: 67 SIIMPSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTKLGI 228 S+ + SHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKT+LGI Sbjct: 5 SLAIQSHKSFRTKQKLAKAQKQNRPIPQWIRLRTGNTIRYNAKRRHWRKTRLGI 58