BLASTX nr result
ID: Magnolia22_contig00016210
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00016210 (1706 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CAA78966.1 pollen preferential protein [Lilium longiflorum] CAA7... 59 1e-06 >CAA78966.1 pollen preferential protein [Lilium longiflorum] CAA78977.1 pollen preferential protein [Lilium longiflorum] AAA33399.1 pollen preferential protein [Lilium longiflorum] Length = 182 Score = 59.3 bits (142), Expect = 1e-06 Identities = 30/80 (37%), Positives = 46/80 (57%), Gaps = 1/80 (1%) Frame = +3 Query: 1113 CRKAMLKKNRKRKIGLLPQQQQLELSKRFNEMELQKLENIV-TAETWPVKSPSMVVLDME 1289 CR+A+ +K RKR + +S ++ + + T ETWP KSPS+ V + E Sbjct: 101 CRRALSQKRRKRVKKRSTTLRSRAMSFVSDDEDFGVPSFVPRTPETWPSKSPSVEVAEKE 160 Query: 1290 QEVWTQLYGTGFWRNPSEKE 1349 +E+W + Y GFWR+PS+KE Sbjct: 161 EEMWAEFYSAGFWRSPSQKE 180