BLASTX nr result
ID: Magnolia22_contig00016062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00016062 (332 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KZZ96415.1 Ribosomal protein S30 [Ascosphaera apis ARSEF 7405] 64 2e-11 OJJ45418.1 hypothetical protein ASPZODRAFT_17634 [Penicilliopsis... 61 3e-10 KZN92636.1 40S ribosomal protein S30-B [Penicillium chrysogenum]... 59 2e-09 XP_018001464.1 40S ribosomal protein S30 [Phialophora attae] KPI... 59 2e-09 CDM27066.1 40S ribosomal protein S30 [Penicillium roqueforti FM1... 59 2e-09 CEJ61070.1 Putative Ribosomal S30/ubiquitin fusion [Penicillium ... 59 2e-09 EPS29473.1 hypothetical protein PDE_04423 [Penicillium oxalicum ... 59 2e-09 SCW00606.1 LAFE_0C07910g1_1 [Lachancea fermentati] 59 2e-09 XP_003671999.1 ribosomal protein S30 [Naumovozyma dairenensis CB... 59 2e-09 KLJ12838.1 40S ribosomal protein S30 [Emmonsia parva UAMH 139] 59 2e-09 EWC48958.1 40S ribosomal protein S30 [Drechslerella stenobrocha ... 58 3e-09 5IT9_EE Chain e, Structure Of The Yeast Kluyveromyces Lactis Sma... 58 4e-09 XP_020059042.1 hypothetical protein ASPACDRAFT_40016 [Aspergillu... 58 5e-09 CZT12339.1 probable 40S ribosomal protein S30.e, cytosolic [Rhyn... 58 5e-09 CZT50882.1 probable 40S ribosomal protein S30.e, cytosolic [Rhyn... 58 5e-09 XP_003306957.1 40S ribosomal protein S30 [Pyrenophora teres f. t... 58 5e-09 XP_008086848.1 hypothetical protein GLAREA_01441 [Glarea lozoyen... 58 5e-09 XP_008021678.1 hypothetical protein SETTUDRAFT_166858 [Setosphae... 58 5e-09 XP_452414.1 40S ribosomal protein S30 [Kluyveromyces lactis NRRL... 58 5e-09 XP_007690990.1 hypothetical protein COCMIDRAFT_103343 [Bipolaris... 58 5e-09 >KZZ96415.1 Ribosomal protein S30 [Ascosphaera apis ARSEF 7405] Length = 62 Score = 63.5 bits (153), Expect = 2e-11 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPT 129 GRAYKR++YTRRFVNVTMTGGKRKMNPAPT Sbjct: 32 GRAYKRLLYTRRFVNVTMTGGKRKMNPAPT 61 >OJJ45418.1 hypothetical protein ASPZODRAFT_17634 [Penicilliopsis zonata CBS 506.65] Length = 62 Score = 60.8 bits (146), Expect = 3e-10 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRAYKR++YTRRFVNVT+TGGKRKMNPAP++ Sbjct: 32 GRAYKRVLYTRRFVNVTLTGGKRKMNPAPSS 62 >KZN92636.1 40S ribosomal protein S30-B [Penicillium chrysogenum] OGE52959.1 hypothetical protein PENARI_c009G02307 [Penicillium arizonense] Length = 62 Score = 58.9 bits (141), Expect = 2e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAP 126 GRAYKR++YTRRFVNVTMTGGKRKMNP P Sbjct: 32 GRAYKRVLYTRRFVNVTMTGGKRKMNPNP 60 >XP_018001464.1 40S ribosomal protein S30 [Phialophora attae] KPI41501.1 40S ribosomal protein S30 [Phialophora attae] Length = 62 Score = 58.9 bits (141), Expect = 2e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVTMTGGKRKMNP PTT Sbjct: 32 GRAKKRITYTRRFVNVTMTGGKRKMNPNPTT 62 >CDM27066.1 40S ribosomal protein S30 [Penicillium roqueforti FM164] CRL25302.1 Ribosomal protein S30 [Penicillium camemberti] Length = 62 Score = 58.9 bits (141), Expect = 2e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAP 126 GRAYKR++YTRRFVNVTMTGGKRKMNP P Sbjct: 32 GRAYKRILYTRRFVNVTMTGGKRKMNPNP 60 >CEJ61070.1 Putative Ribosomal S30/ubiquitin fusion [Penicillium brasilianum] Length = 62 Score = 58.9 bits (141), Expect = 2e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAP 126 GRAYKR++YTRRFVNVTMTGGKRKMNP P Sbjct: 32 GRAYKRILYTRRFVNVTMTGGKRKMNPNP 60 >EPS29473.1 hypothetical protein PDE_04423 [Penicillium oxalicum 114-2] Length = 62 Score = 58.9 bits (141), Expect = 2e-09 Identities = 26/29 (89%), Positives = 28/29 (96%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAP 126 GRAYKR++YTRRFVNVTMTGGKRKMNP P Sbjct: 32 GRAYKRILYTRRFVNVTMTGGKRKMNPNP 60 >SCW00606.1 LAFE_0C07910g1_1 [Lachancea fermentati] Length = 63 Score = 58.9 bits (141), Expect = 2e-09 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRAYKRM+YTRRFVNVT+T GKRKMNP+P++ Sbjct: 32 GRAYKRMLYTRRFVNVTLTNGKRKMNPSPSS 62 >XP_003671999.1 ribosomal protein S30 [Naumovozyma dairenensis CBS 421] CCD26756.1 hypothetical protein NDAI_0I01870 [Naumovozyma dairenensis CBS 421] Length = 63 Score = 58.9 bits (141), Expect = 2e-09 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRAYKR++YTRRFVNVT+T GKRKMNP+P T Sbjct: 32 GRAYKRLLYTRRFVNVTLTNGKRKMNPSPNT 62 >KLJ12838.1 40S ribosomal protein S30 [Emmonsia parva UAMH 139] Length = 63 Score = 58.5 bits (140), Expect = 2e-09 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVTMTGGKRKMNP PTT Sbjct: 32 GRAKKRLQYTRRFVNVTMTGGKRKMNPNPTT 62 >EWC48958.1 40S ribosomal protein S30 [Drechslerella stenobrocha 248] Length = 62 Score = 58.2 bits (139), Expect = 3e-09 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR++YTRRFVNVT+TGGKRKMNP PTT Sbjct: 32 GRAKKRILYTRRFVNVTLTGGKRKMNPNPTT 62 >5IT9_EE Chain e, Structure Of The Yeast Kluyveromyces Lactis Small Ribosomal Subunit In Complex With The Cricket Paralysis Virus Ires. Length = 55 Score = 57.8 bits (138), Expect = 4e-09 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRAYKR++YTRRFVNVT+T GKRKMNP+P++ Sbjct: 24 GRAYKRLLYTRRFVNVTLTNGKRKMNPSPSS 54 >XP_020059042.1 hypothetical protein ASPACDRAFT_40016 [Aspergillus aculeatus ATCC 16872] OJK02703.1 hypothetical protein ASPACDRAFT_40016 [Aspergillus aculeatus ATCC 16872] Length = 62 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPT 129 GRAYKR+VYTRRFVNVT+TGGKRKMN PT Sbjct: 32 GRAYKRVVYTRRFVNVTLTGGKRKMNANPT 61 >CZT12339.1 probable 40S ribosomal protein S30.e, cytosolic [Rhynchosporium commune] Length = 62 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVT+TGGKRKMNP PTT Sbjct: 32 GRAKKRITYTRRFVNVTLTGGKRKMNPNPTT 62 >CZT50882.1 probable 40S ribosomal protein S30.e, cytosolic [Rhynchosporium secalis] CZS96479.1 probable 40S ribosomal protein S30.e, cytosolic [Rhynchosporium agropyri] Length = 62 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVT+TGGKRKMNP PTT Sbjct: 32 GRAKKRITYTRRFVNVTLTGGKRKMNPNPTT 62 >XP_003306957.1 40S ribosomal protein S30 [Pyrenophora teres f. teres 0-1] XP_003836602.1 similar to 40S ribosomal protein S30 [Leptosphaeria maculans JN3] XP_007694161.1 hypothetical protein COCSADRAFT_31947 [Bipolaris sorokiniana ND90Pr] XP_007706647.1 hypothetical protein COCCADRAFT_400 [Bipolaris zeicola 26-R-13] XP_014084844.1 hypothetical protein COCC4DRAFT_35810 [Bipolaris maydis ATCC 48331] XP_014552633.1 hypothetical protein COCVIDRAFT_30057 [Bipolaris victoriae FI3] XP_018390625.1 ribosomal protein S30 [Alternaria alternata] EFQ84930.1 hypothetical protein PTT_20275 [Pyrenophora teres f. teres 0-1] CBX93237.1 similar to 40S ribosomal protein S30 [Leptosphaeria maculans JN3] EMD69192.1 hypothetical protein COCSADRAFT_31947 [Bipolaris sorokiniana ND90Pr] EMD96075.1 hypothetical protein COCHEDRAFT_1210319 [Bipolaris maydis C5] ENI10935.1 hypothetical protein COCC4DRAFT_35810 [Bipolaris maydis ATCC 48331] EUC38978.1 hypothetical protein COCCADRAFT_400 [Bipolaris zeicola 26-R-13] EUN23059.1 hypothetical protein COCVIDRAFT_30057 [Bipolaris victoriae FI3] OAG25204.1 ribosomal protein S30 [Alternaria alternata] Length = 62 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVTMTGGKRKMNP PT+ Sbjct: 32 GRAKKRLTYTRRFVNVTMTGGKRKMNPNPTS 62 >XP_008086848.1 hypothetical protein GLAREA_01441 [Glarea lozoyensis ATCC 20868] XP_018077785.1 ribosomal protein S30 [Phialocephala scopiformis] EPE25529.1 hypothetical protein GLAREA_01441 [Glarea lozoyensis ATCC 20868] KUJ23430.1 ribosomal protein S30 [Phialocephala scopiformis] Length = 62 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVT+TGGKRKMNP PTT Sbjct: 32 GRAKKRITYTRRFVNVTLTGGKRKMNPNPTT 62 >XP_008021678.1 hypothetical protein SETTUDRAFT_166858 [Setosphaeria turcica Et28A] EOA91002.1 hypothetical protein SETTUDRAFT_166858 [Setosphaeria turcica Et28A] Length = 62 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVTMTGGKRKMNP PT+ Sbjct: 32 GRAKKRLTYTRRFVNVTMTGGKRKMNPNPTS 62 >XP_452414.1 40S ribosomal protein S30 [Kluyveromyces lactis NRRL Y-1140] 3J80_EE Chain e, Cryoem Structure Of 40s-eif1-eif1a Preinitiation Complex 3J81_EE Chain e, Cryoem Structure Of A Partial Yeast 48s Preinitiation Complex 3JAM_EE Chain e, Cryoem Structure Of 40s-eif1a-eif1 Complex From Yeast CAH01265.1 KLLA0C04809p [Kluyveromyces lactis] Length = 63 Score = 57.8 bits (138), Expect = 5e-09 Identities = 24/31 (77%), Positives = 30/31 (96%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRAYKR++YTRRFVNVT+T GKRKMNP+P++ Sbjct: 32 GRAYKRLLYTRRFVNVTLTNGKRKMNPSPSS 62 >XP_007690990.1 hypothetical protein COCMIDRAFT_103343 [Bipolaris oryzae ATCC 44560] EUC42506.1 hypothetical protein COCMIDRAFT_103343 [Bipolaris oryzae ATCC 44560] Length = 64 Score = 57.8 bits (138), Expect = 5e-09 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 40 GRAYKRMVYTRRFVNVTMTGGKRKMNPAPTT 132 GRA KR+ YTRRFVNVTMTGGKRKMNP PT+ Sbjct: 34 GRAKKRLTYTRRFVNVTMTGGKRKMNPNPTS 64