BLASTX nr result
ID: Magnolia22_contig00015934
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00015934 (451 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KVI05472.1 Protein of unknown function DUF647 [Cynara cardunculu... 55 5e-06 EEF50749.1 conserved hypothetical protein [Ricinus communis] 55 6e-06 XP_002512080.2 PREDICTED: protein root UVB sensitive 3 [Ricinus ... 55 7e-06 XP_010553364.1 PREDICTED: putative white-brown complex homolog p... 55 8e-06 GAV61448.1 DUF647 domain-containing protein [Cephalotus follicul... 54 9e-06 >KVI05472.1 Protein of unknown function DUF647 [Cynara cardunculus var. scolymus] Length = 434 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 371 QSSGWKTERLLSSSIVWREHWIHGPSNEKIN 279 QSSGWKTERLLSSSI+WR +W HG ++KIN Sbjct: 404 QSSGWKTERLLSSSIIWRANWSHGAPDKKIN 434 >EEF50749.1 conserved hypothetical protein [Ricinus communis] Length = 380 Score = 54.7 bits (130), Expect = 6e-06 Identities = 21/30 (70%), Positives = 28/30 (93%) Frame = -3 Query: 368 SSGWKTERLLSSSIVWREHWIHGPSNEKIN 279 SSGWKTERLLS SI+WR +WI+GPS++K++ Sbjct: 351 SSGWKTERLLSQSIIWRANWIYGPSDDKVD 380 >XP_002512080.2 PREDICTED: protein root UVB sensitive 3 [Ricinus communis] Length = 433 Score = 54.7 bits (130), Expect = 7e-06 Identities = 21/30 (70%), Positives = 28/30 (93%) Frame = -3 Query: 368 SSGWKTERLLSSSIVWREHWIHGPSNEKIN 279 SSGWKTERLLS SI+WR +WI+GPS++K++ Sbjct: 404 SSGWKTERLLSQSIIWRANWIYGPSDDKVD 433 >XP_010553364.1 PREDICTED: putative white-brown complex homolog protein 30 [Tarenaya hassleriana] XP_010553365.1 PREDICTED: putative white-brown complex homolog protein 30 [Tarenaya hassleriana] Length = 1095 Score = 54.7 bits (130), Expect = 8e-06 Identities = 40/98 (40%), Positives = 47/98 (47%) Frame = -2 Query: 318 GTLDSWSFE*KDQLDGYPI*V*FAIIQSPCHVYFASVCLVKDPGLTQSTSKY*RLGEFK* 139 GT DSW D +DG + SP S C +T S+ Y R G Sbjct: 231 GTADSW-----DDVDGSA-----DMFCSP-----GSYCPTTIQKITCSSGHYCRKGSTS- 274 Query: 138 VMTGCFKLNTCKSNTANQNIHAYGIMLIVLFKLVVITV 25 CFKL TC NTANQNIHAYG +LIV L++I V Sbjct: 275 -QKPCFKLATCNPNTANQNIHAYGAILIVALSLLMIIV 311 >GAV61448.1 DUF647 domain-containing protein [Cephalotus follicularis] Length = 439 Score = 54.3 bits (129), Expect = 9e-06 Identities = 23/31 (74%), Positives = 27/31 (87%) Frame = -3 Query: 371 QSSGWKTERLLSSSIVWREHWIHGPSNEKIN 279 +SSGWKTERLLS SI+WR +W GPSNEKI+ Sbjct: 409 RSSGWKTERLLSHSIIWRANWTCGPSNEKID 439