BLASTX nr result
ID: Magnolia22_contig00015669
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Magnolia22_contig00015669 (508 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_018249717.1 hypothetical protein FOXG_20544 [Fusarium oxyspor... 52 2e-06 KFH43929.1 hypothetical protein ACRE_053060 [Acremonium chrysoge... 51 6e-06 >XP_018249717.1 hypothetical protein FOXG_20544 [Fusarium oxysporum f. sp. lycopersici 4287] XP_018757512.1 hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] EWG51321.1 hypothetical protein FVEG_16784 [Fusarium verticillioides 7600] EWY85261.1 hypothetical protein FOYG_12499 [Fusarium oxysporum FOSC 3-a] EWZ35712.1 hypothetical protein FOZG_11578 [Fusarium oxysporum Fo47] EWZ96292.1 hypothetical protein FOWG_03707 [Fusarium oxysporum f. sp. lycopersici MN25] EXA37840.1 hypothetical protein FOVG_11928 [Fusarium oxysporum f. sp. pisi HDV247] EXK30141.1 hypothetical protein FOMG_13780 [Fusarium oxysporum f. sp. melonis 26406] EXK90269.1 hypothetical protein FOQG_07096 [Fusarium oxysporum f. sp. raphani 54005] EXL55250.1 hypothetical protein FOCG_05914 [Fusarium oxysporum f. sp. radicis-lycopersici 26381] EXL81768.1 hypothetical protein FOPG_05108 [Fusarium oxysporum f. sp. conglutinans race 2 54008] EXM05656.1 hypothetical protein FOIG_04172 [Fusarium oxysporum f. sp. cubense tropical race 4 54006] EXM27212.1 hypothetical protein FOTG_06566 [Fusarium oxysporum f. sp. vasinfectum 25433] KNB11672.1 hypothetical protein FOXG_20544 [Fusarium oxysporum f. sp. lycopersici 4287] Length = 42 Score = 52.0 bits (123), Expect = 2e-06 Identities = 23/41 (56%), Positives = 27/41 (65%) Frame = +3 Query: 111 MPLLWTKNVXXXXXXXXVTVDRHGVRRNPFRFTFGKFSCFR 233 M L W+K V V VD+HGVRR P+RF+ GKFSCFR Sbjct: 1 MGLFWSKGVGGRHFGTSVHVDKHGVRRGPWRFSLGKFSCFR 41 >KFH43929.1 hypothetical protein ACRE_053060 [Acremonium chrysogenum ATCC 11550] Length = 43 Score = 50.8 bits (120), Expect = 6e-06 Identities = 22/41 (53%), Positives = 26/41 (63%) Frame = +3 Query: 111 MPLLWTKNVXXXXXXXXVTVDRHGVRRNPFRFTFGKFSCFR 233 M L W K + V VDRHGVRR P+RF+ GK+SCFR Sbjct: 1 MGLFWGKGIGTRHFGTSVRVDRHGVRRGPWRFSLGKYSCFR 41